PDB entry 3ejf

View 3ejf on RCSB PDB site
Description: Crystal structure of IBV X-domain at pH 8.5
Class: hydrolase
Keywords: IBV, coronavirus, X-domain, macro domain, Nsp3, ADRP, Hydrolase, Ribosomal frameshifting, RNA-binding
Deposited on 2008-09-18, released 2008-09-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: non-structural protein 3
    Species: Avian infectious bronchitis virus (strain Beaudette) [TaxId:11120]
    Gene: 1a
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3ejfa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3ejfA (A:)
gamapatcekpkfleyktcvgdltvviakaldefkefcivnaanehmthgsgvakaiadf
cgldfveycedyvkkhgpqqrlvtpsfvkgiqcvnnvvgprhgdnnlheklvaayknvlv
dgvvnyvvpvlslgifgvdfkmsidamreafegctirvllfslsqehidyfdvtck

    Sequence, based on observed residues (ATOM records): (download) 
    >3ejfA (A:)
kpkfleyktcvgdltvviakaldefkefcivnaanehmthgsgvakaiadfcgldfveyc
edyvkkhgpqqrlvtpsfvkgiqcvnnvvgprhgdnnlheklvaayknvlvdgvvnyvvp
vlslgifgvdfkmsidamreafegctirvllfslsqehidyfdvtc