PDB entry 3eje

View 3eje on RCSB PDB site
Description: Crystal Structure of P450BioI in complex with octadec-9Z-enoic acid ligated Acyl Carrier Protein
Class: oxidoreductase/lipid transport
Keywords: Protein-Protein Complex, Cytochrome P450 Fold, Carrier Protein, 4-Helix Bundle, Cytoplasm, Fatty acid biosynthesis, Lipid synthesis, Phosphopantetheine, Biotin biosynthesis, Heme, Iron, Metal-binding, Monooxygenase, Oxidoreductase, OXIDOREDUCTASE/LIPID TRANSPORT COMPLEX
Deposited on 2008-09-18, released 2008-10-07
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.242
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acyl carrier protein
    Species: Escherichia coli [TaxId:83333]
    Gene: acpP, b1094, JW1080
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6A8 (19-End)
      • expression tag (17-18)
    Domains in SCOPe 2.03: d3ejea_
  • Chain 'B':
    Compound: Biotin biosynthesis cytochrome P450-like enzyme
    Species: Bacillus subtilis [TaxId:1423]
    Gene: bioI, CYP107H, BSU30190
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3ejeb_
  • Chain 'C':
    Compound: Acyl carrier protein
    Species: Escherichia coli [TaxId:83333]
    Gene: acpP, b1094, JW1080
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6A8 (19-End)
      • expression tag (17-18)
    Domains in SCOPe 2.03: d3ejec_
  • Chain 'D':
    Compound: Biotin biosynthesis cytochrome P450-like enzyme
    Species: Bacillus subtilis [TaxId:1423]
    Gene: bioI, CYP107H, BSU30190
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3ejed_
  • Chain 'E':
    Compound: Acyl carrier protein
    Species: Escherichia coli [TaxId:83333]
    Gene: acpP, b1094, JW1080
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6A8 (19-End)
      • expression tag (17-18)
    Domains in SCOPe 2.03: d3ejee_
  • Chain 'F':
    Compound: Biotin biosynthesis cytochrome P450-like enzyme
    Species: Bacillus subtilis [TaxId:1423]
    Gene: bioI, CYP107H, BSU30190
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3ejef_
  • Chain 'G':
    Compound: Acyl carrier protein
    Species: Escherichia coli [TaxId:83333]
    Gene: acpP, b1094, JW1080
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6A8 (19-End)
      • expression tag (17-18)
    Domains in SCOPe 2.03: d3ejeg_
  • Chain 'H':
    Compound: Biotin biosynthesis cytochrome P450-like enzyme
    Species: Bacillus subtilis [TaxId:1423]
    Gene: bioI, CYP107H, BSU30190
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3ejeh_
  • Heterogens: ZMO, HTG, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ejeA (A:)
    gsshhhhhhssglvprgshmstieervkkiigeqlgvkqeevtnnasfvedlgadsldtv
    elvmaleeefdteipdeeaekittvqaaidyinghqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ejeA (A:)
    shmstieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipde
    eaekittvqaaidyingh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ejeB (B:)
    tiasstasseflknpysfydtlravhpiykgsflkypgwyvtgyeetaailkdarfkvrt
    plpesstkyqdlshvqnqmmlfqnqpdhrrlrtlasgaftprttesyqpyiietvhhlld
    qvqgkkkmevisdfafplasfvianiigvpeedreqlkewaasliqtidftrsrkalteg
    nimavqamayfkeliqkrkrhpqqdmismllkgrekdklteeeaastcillaiaghettv
    nlisnsvlcllqhpeqllklrenpdligtaveeclryesptqmtarvasedidicgvtir
    qgeqvylllgaanrdpsiftnpdvfditrspnphlsfghghhvclgsslarleaqiaint
    llqrmpslnladfewryrplfgfraleelpvtfeaswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ejeB (B:)
    seflknpysfydtlravhpiykgsflkypgwyvtgyeetaailkdarfkvrtplpesstk
    yqdlshvqnqmmlfqnqpdhrrlrtlasgaftprttesyqpyiietvhhlldqvqgkkkm
    evisdfafplasfvianiigvpeedreqlkewaasliqtidftrsrkaltegnimavqam
    ayfkeliqkrkrhpqqdmismllkklteeeaastcillaiaghettvnlisnsvlcllqh
    peqllklrenpdligtaveeclryesptqmtarvasedidicgvtirqgeqvylllgaan
    rdpsiftnpdvfditrspnphlsfghghhvclgsslarleaqiaintllqrmpslnlawr
    yrplfgfraleelpvtfe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ejeC (C:)
    gsshhhhhhssglvprgshmstieervkkiigeqlgvkqeevtnnasfvedlgadsldtv
    elvmaleeefdteipdeeaekittvqaaidyinghqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ejeC (C:)
    shmstieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipde
    eaekittvqaaidyingh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ejeD (D:)
    tiasstasseflknpysfydtlravhpiykgsflkypgwyvtgyeetaailkdarfkvrt
    plpesstkyqdlshvqnqmmlfqnqpdhrrlrtlasgaftprttesyqpyiietvhhlld
    qvqgkkkmevisdfafplasfvianiigvpeedreqlkewaasliqtidftrsrkalteg
    nimavqamayfkeliqkrkrhpqqdmismllkgrekdklteeeaastcillaiaghettv
    nlisnsvlcllqhpeqllklrenpdligtaveeclryesptqmtarvasedidicgvtir
    qgeqvylllgaanrdpsiftnpdvfditrspnphlsfghghhvclgsslarleaqiaint
    llqrmpslnladfewryrplfgfraleelpvtfeaswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ejeD (D:)
    tasseflknpysfydtlravhpiykgsflkypgwyvtgyeetaailkdarfkvrtplpes
    stkyqdlshvqnqmmlfqnqpdhrrlrtlasgaftprttesyqpyiietvhhlldqvqgk
    kkmevisdfafplasfvianiigvpeedreqlkewaasliqtidftrsrkaltegnimav
    qamayfkeliqkrkrhpqqdmismllkgrklteeeaastcillaiaghettvnlisnsvl
    cllqhpeqllklrenpdligtaveeclryesptqmtarvasedidicgvtirqgeqvyll
    lgaanrdpsiftnpdvfditrspnphlsfghghhvclgsslarleaqiaintllqrmpsl
    nladfwryrplfgfraleelpvtfe
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3ejeE (E:)
    gsshhhhhhssglvprgshmstieervkkiigeqlgvkqeevtnnasfvedlgadsldtv
    elvmaleeefdteipdeeaekittvqaaidyinghqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ejeE (E:)
    shmstieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipde
    eaekittvqaaidyin
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3ejeF (F:)
    tiasstasseflknpysfydtlravhpiykgsflkypgwyvtgyeetaailkdarfkvrt
    plpesstkyqdlshvqnqmmlfqnqpdhrrlrtlasgaftprttesyqpyiietvhhlld
    qvqgkkkmevisdfafplasfvianiigvpeedreqlkewaasliqtidftrsrkalteg
    nimavqamayfkeliqkrkrhpqqdmismllkgrekdklteeeaastcillaiaghettv
    nlisnsvlcllqhpeqllklrenpdligtaveeclryesptqmtarvasedidicgvtir
    qgeqvylllgaanrdpsiftnpdvfditrspnphlsfghghhvclgsslarleaqiaint
    llqrmpslnladfewryrplfgfraleelpvtfeaswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ejeF (F:)
    seflknpysfydtlravhpiykgsflkypgwyvtgyeetaailkdarfkvrtplpesstk
    yqdlshvqnqmmlfqnqpdhrrlrtlasgaftprttesyqpyiietvhhlldqvqgkkkm
    evisdfafplasfvianiigvpeedreqlkewaasliqtidftrsrkaltegnimavqam
    ayfkeliqkrkrhpqqdmismllkklteeeaastcillaiaghettvnlisnsvlcllqh
    peqllklrenpdligtaveeclryesptqmtarvasedidicgvtirqgeqvylllgaan
    rdpsiftnpdvfditrspnphlsfghghhvclgsslarleaqiaintllqrmpslnlade
    wryrplfgfraleelpvtfe
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3ejeG (G:)
    gsshhhhhhssglvprgshmstieervkkiigeqlgvkqeevtnnasfvedlgadsldtv
    elvmaleeefdteipdeeaekittvqaaidyinghqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ejeG (G:)
    shmstieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipde
    eaekittvqaaidyi
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3ejeH (H:)
    tiasstasseflknpysfydtlravhpiykgsflkypgwyvtgyeetaailkdarfkvrt
    plpesstkyqdlshvqnqmmlfqnqpdhrrlrtlasgaftprttesyqpyiietvhhlld
    qvqgkkkmevisdfafplasfvianiigvpeedreqlkewaasliqtidftrsrkalteg
    nimavqamayfkeliqkrkrhpqqdmismllkgrekdklteeeaastcillaiaghettv
    nlisnsvlcllqhpeqllklrenpdligtaveeclryesptqmtarvasedidicgvtir
    qgeqvylllgaanrdpsiftnpdvfditrspnphlsfghghhvclgsslarleaqiaint
    llqrmpslnladfewryrplfgfraleelpvtfeaswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ejeH (H:)
    tasseflknpysfydtlravhpiykgsflkypgwyvtgyeetaailkdarfkvrtplpes
    stkyqdlshvqnqmmlfqnqpdhrrlrtlasgaftprttesyqpyiietvhhlldqvqgk
    kkmevisdfafplasfvianiigvpeedreqlkewaasliqtidftrsrkaltegnimav
    qamayfkeliqkrkrhpqqdmismllkkdklteeeaastcillaiaghettvnlisnsvl
    cllqhpeqllklrenpdligtaveeclryesptqmtarvasedidicgvtirqgeqvyll
    lgaanrdpsiftnpdvfditrspnphlsfghghhvclgsslarleaqiaintllqrmpsl
    nlawryrplfgfraleelpvtfe