PDB entry 3ejc

View 3ejc on RCSB PDB site
Description: Full length Receptor Binding Protein from Lactococcal phage TP901-1
Class: viral protein, sugar binding protein
Keywords: Lactococcus lactis, siphoviridae, receptor binding protein, phage TP901-1, P335 species, VIRAL PROTEIN, SUGAR BINDING PROTEIN
Deposited on 2008-09-18, released 2009-10-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.197
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Baseplate protein (BPP)
    Species: Lactococcus phage TP901-1 [TaxId:35345]
    Gene: bpp
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9G096 (Start-162)
      • expression tag (163)
    Domains in SCOPe 2.06: d3ejca1, d3ejca2, d3ejca3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ejcA (A:)
    masikkvyrgmkngaetinddleainseltsggnvvhktgdetiagkktftgnvevngsl
    tlptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcs
    lvghmvggwnafhidipssgvcqwfgptassgtprgtgtypidhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ejcA (A:)
    asikkvyrgmkngaetinddleainseltsggnvvhktgdetiagkktftgnvevngslt
    lptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcsl
    vghmvggwnafhidipssgvcqwfgptassgtprgtgtypidh