PDB entry 3ejb

View 3ejb on RCSB PDB site
Description: Crystal Structure of P450BioI in complex with tetradecanoic acid ligated Acyl Carrier Protein
Class: Oxidoreductase/Lipid Transport
Keywords: Protein-Protein Complex, Cytochrome P450 Fold, Carrier Protein, 4-Helix Bundle, Cytoplasm, Fatty acid biosynthesis, Lipid synthesis, Phosphopantetheine, Biotin biosynthesis, Heme, Iron, Metal-binding, Monooxygenase, Oxidoreductase, Oxidoreductase/Lipid Transport COMPLEX
Deposited on 2008-09-18, released 2008-10-07
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.224
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acyl carrier protein
    Species: Escherichia coli [TaxId:83333]
    Gene: acpP, b1094, JW1080
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6A8 (19-End)
      • expression tag (17-18)
    Domains in SCOPe 2.03: d3ejba_
  • Chain 'B':
    Compound: Biotin biosynthesis cytochrome P450-like enzyme
    Species: Bacillus subtilis [TaxId:1423]
    Gene: bioI, CYP107H, BSU30190
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3ejbb_
  • Chain 'C':
    Compound: Acyl carrier protein
    Species: Escherichia coli [TaxId:83333]
    Gene: acpP, b1094, JW1080
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6A8 (19-End)
      • expression tag (16-18)
    Domains in SCOPe 2.03: d3ejbc_
  • Chain 'D':
    Compound: Biotin biosynthesis cytochrome P450-like enzyme
    Species: Bacillus subtilis [TaxId:1423]
    Gene: bioI, CYP107H, BSU30190
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3ejbd_
  • Chain 'E':
    Compound: Acyl carrier protein
    Species: Escherichia coli [TaxId:83333]
    Gene: acpP, b1094, JW1080
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6A8 (19-End)
      • expression tag (17-18)
    Domains in SCOPe 2.03: d3ejbe_
  • Chain 'F':
    Compound: Biotin biosynthesis cytochrome P450-like enzyme
    Species: Bacillus subtilis [TaxId:1423]
    Gene: bioI, CYP107H, BSU30190
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3ejbf_
  • Chain 'G':
    Compound: Acyl carrier protein
    Species: Escherichia coli [TaxId:83333]
    Gene: acpP, b1094, JW1080
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6A8 (19-End)
      • expression tag (16-18)
    Domains in SCOPe 2.03: d3ejbg_
  • Chain 'H':
    Compound: Biotin biosynthesis cytochrome P450-like enzyme
    Species: Bacillus subtilis [TaxId:1423]
    Gene: bioI, CYP107H, BSU30190
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3ejbh_
  • Heterogens: ZMP, HTG, HEM, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ejbA (A:)
    gsshhhhhhssglvprgshmstieervkkiigeqlgvkqeevtnnasfvedlgadsldtv
    elvmaleeefdteipdeeaekittvqaaidyinghqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ejbA (A:)
    shmstieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipde
    eaekittvqaaidyingh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ejbB (B:)
    tiasstasseflknpysfydtlravhpiykgsflkypgwyvtgyeetaailkdarfkvrt
    plpesstkyqdlshvqnqmmlfqnqpdhrrlrtlasgaftprttesyqpyiietvhhlld
    qvqgkkkmevisdfafplasfvianiigvpeedreqlkewaasliqtidftrsrkalteg
    nimavqamayfkeliqkrkrhpqqdmismllkgrekdklteeeaastcillaiaghettv
    nlisnsvlcllqhpeqllklrenpdligtaveeclryesptqmtarvasedidicgvtir
    qgeqvylllgaanrdpsiftnpdvfditrspnphlsfghghhvclgsslarleaqiaint
    llqrmpslnladfewryrplfgfraleelpvtfeaswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ejbB (B:)
    seflknpysfydtlravhpiykgsflkypgwyvtgyeetaailkdarfkvrtplpesstk
    yqdlshvqnqmmlfqnqpdhrrlrtlasgaftprttesyqpyiietvhhlldqvqgkkkm
    evisdfafplasfvianiigvpeedreqlkewaasliqtidftrsrkaltegnimavqam
    ayfkeliqkrkrhpqqdmismllkgklteeeaastcillaiaghettvnlisnsvlcllq
    hpeqllklrenpdligtaveeclryesptqmtarvasedidicgvtirqgeqvylllgaa
    nrdpsiftnpdvfditrspnphlsfghghhvclgsslarleaqiaintllqrmpslnlae
    wryrplfgfraleelpvtfe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ejbC (C:)
    gsshhhhhhssglvprgshmstieervkkiigeqlgvkqeevtnnasfvedlgadsldtv
    elvmaleeefdteipdeeaekittvqaaidyinghqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ejbC (C:)
    gshmstieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipd
    eeaekittvqaaidyin
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ejbD (D:)
    tiasstasseflknpysfydtlravhpiykgsflkypgwyvtgyeetaailkdarfkvrt
    plpesstkyqdlshvqnqmmlfqnqpdhrrlrtlasgaftprttesyqpyiietvhhlld
    qvqgkkkmevisdfafplasfvianiigvpeedreqlkewaasliqtidftrsrkalteg
    nimavqamayfkeliqkrkrhpqqdmismllkgrekdklteeeaastcillaiaghettv
    nlisnsvlcllqhpeqllklrenpdligtaveeclryesptqmtarvasedidicgvtir
    qgeqvylllgaanrdpsiftnpdvfditrspnphlsfghghhvclgsslarleaqiaint
    llqrmpslnladfewryrplfgfraleelpvtfeaswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ejbD (D:)
    tasseflknpysfydtlravhpiykgsflkypgwyvtgyeetaailkdarfkvrtplpes
    stkyqdlshvqnqmmlfqnqpdhrrlrtlasgaftprttesyqpyiietvhhlldqvqgk
    kkmevisdfafplasfvianiigvpeedreqlkewaasliqtidftrsrkaltegnimav
    qamayfkeliqkrkrhpqqdmismllkgrekdklteeeaastcillaiaghettvnlisn
    svlcllqhpeqllklrenpdligtaveeclryesptqmtarvasedidicgvtirqgeqv
    ylllgaanrdpsiftnpdvfditrspnphlsfghghhvclgsslarleaqiaintllqrm
    pslnlawryrplfgfraleelpvtfe
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3ejbE (E:)
    gsshhhhhhssglvprgshmstieervkkiigeqlgvkqeevtnnasfvedlgadsldtv
    elvmaleeefdteipdeeaekittvqaaidyinghqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ejbE (E:)
    shmstieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipde
    eaekittvqaaidyingh
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3ejbF (F:)
    tiasstasseflknpysfydtlravhpiykgsflkypgwyvtgyeetaailkdarfkvrt
    plpesstkyqdlshvqnqmmlfqnqpdhrrlrtlasgaftprttesyqpyiietvhhlld
    qvqgkkkmevisdfafplasfvianiigvpeedreqlkewaasliqtidftrsrkalteg
    nimavqamayfkeliqkrkrhpqqdmismllkgrekdklteeeaastcillaiaghettv
    nlisnsvlcllqhpeqllklrenpdligtaveeclryesptqmtarvasedidicgvtir
    qgeqvylllgaanrdpsiftnpdvfditrspnphlsfghghhvclgsslarleaqiaint
    llqrmpslnladfewryrplfgfraleelpvtfeaswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ejbF (F:)
    eflknpysfydtlravhpiykgsflkypgwyvtgyeetaailkdarfkvrtplpesstky
    qdlshvqnqmmlfqnqpdhrrlrtlasgaftprttesyqpyiietvhhlldqvqgkkkme
    visdfafplasfvianiigvpeedreqlkewaasliqtidftrsrkaltegnimavqama
    yfkeliqkrkrhpqqdmismllkgklteeeaastcillaiaghettvnlisnsvlcllqh
    peqllklrenpdligtaveeclryesptqmtarvasedidicgvtirqgeqvylllgaan
    rdpsiftnpdvfditrspnphlsfghghhvclgsslarleaqiaintllqrmpslnlawr
    yrplfgfraleelpvtfe
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3ejbG (G:)
    gsshhhhhhssglvprgshmstieervkkiigeqlgvkqeevtnnasfvedlgadsldtv
    elvmaleeefdteipdeeaekittvqaaidyinghqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ejbG (G:)
    gshmstieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipd
    eeaekittvqaaidyin
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3ejbH (H:)
    tiasstasseflknpysfydtlravhpiykgsflkypgwyvtgyeetaailkdarfkvrt
    plpesstkyqdlshvqnqmmlfqnqpdhrrlrtlasgaftprttesyqpyiietvhhlld
    qvqgkkkmevisdfafplasfvianiigvpeedreqlkewaasliqtidftrsrkalteg
    nimavqamayfkeliqkrkrhpqqdmismllkgrekdklteeeaastcillaiaghettv
    nlisnsvlcllqhpeqllklrenpdligtaveeclryesptqmtarvasedidicgvtir
    qgeqvylllgaanrdpsiftnpdvfditrspnphlsfghghhvclgsslarleaqiaint
    llqrmpslnladfewryrplfgfraleelpvtfeaswshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ejbH (H:)
    tasseflknpysfydtlravhpiykgsflkypgwyvtgyeetaailkdarfkvrtplpes
    stkyqdlshvqnqmmlfqnqpdhrrlrtlasgaftprttesyqpyiietvhhlldqvqgk
    kkmevisdfafplasfvianiigvpeedreqlkewaasliqtidftrsrkaltegnimav
    qamayfkeliqkrkrhpqqdmismllkgrekdklteeeaastcillaiaghettvnlisn
    svlcllqhpeqllklrenpdligtaveeclryesptqmtarvasedidicgvtirqgeqv
    ylllgaanrdpsiftnpdvfditrspnphlsfghghhvclgsslarleaqiaintllqrm
    pslnladewryrplfgfraleelpvtf