PDB entry 3ej8

View 3ej8 on RCSB PDB site
Description: Structure of double mutant of human iNOS oxygenase domain with bound immidazole
Class: oxidoreductase
Keywords: NITRIC OXIDE SYNTHASE, NOS, HEME, TETRAHYDROBIOPTERIN, OXIDOREDUCTASE Calmodulin-binding, FAD, FMN, Iron, Metal-binding, NADP, Oxidoreductase, Polymorphism, Zinc
Deposited on 2008-09-17, released 2008-10-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.232
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitric oxide synthase, inducible
    Species: Homo sapiens [TaxId:9606]
    Gene: Nos2A, NOS2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35228
      • engineered (204)
      • engineered (223)
    Domains in SCOPe 2.04: d3ej8a_
  • Chain 'B':
    Compound: Nitric oxide synthase, inducible
    Species: Homo sapiens [TaxId:9606]
    Gene: Nos2A, NOS2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35228
      • engineered (204)
      • engineered (223)
    Domains in SCOPe 2.04: d3ej8b_
  • Chain 'C':
    Compound: Nitric oxide synthase, inducible
    Species: Homo sapiens [TaxId:9606]
    Gene: Nos2A, NOS2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35228
      • engineered (204)
      • engineered (223)
    Domains in SCOPe 2.04: d3ej8c_
  • Chain 'D':
    Compound: Nitric oxide synthase, inducible
    Species: Homo sapiens [TaxId:9606]
    Gene: Nos2A, NOS2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35228
      • engineered (204)
      • engineered (223)
    Domains in SCOPe 2.04: d3ej8d_
  • Heterogens: HEC, H4B, ZN, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ej8A (A:)
    prhvriknwgsgmtfqdtlhhkakgiltcrsksclgsimtpksltrgprdkptppdellp
    qaiefvnqyygsfkeakieehlarveavtkeiettgtyqltgdelifatkqawrnaprci
    griqwsnlqvfdarscstaremfehicrhvrystnngnirsaitvfpqrsdgkhdfrvwn
    aqliryagyqmpdgsirgdpanveitqlcidlgwkpkygrfdvlplvlqangrdpelfei
    ppdlvlevamehpkyewfrelelkwyalpavanmllevgglefpgcpfngwymgteigvr
    dfcdvqrynileevgrrmglethklaslwkdqavveiniavlhsfqkqnvtimdhhsaae
    sfmkymqneyrsrggcpadwiwlvppmsgsitpvfhqemlnyvlspfyyyqveawkthvw
    qdek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ej8A (A:)
    rhvriknwgsgmtfqdtlhhkakgiltcrsksclgsimtpksltrgprdkptppdellpq
    aiefvnqyygsfkeakieehlarveavtkeiettgtyqltgdelifatkqawrnaprcig
    riqwsnlqvfdarscstaremfehicrhvrystnngnirsaitvfpqrsdgkhdfrvwna
    qliryagyqmpdgsirgdpanveitqlcidlgwkpkygrfdvlplvlqangrdpelfeip
    pdlvlevamehpkyewfrelelkwyalpavanmllevgglefpgcpfngwymgteigvrd
    fcdvqrynileevgrrmglethklaslwkdqavveiniavlhsfqkqnvtimdhhsaaes
    fmkymqneyrsrggcpadwiwlvppmsgsitpvfhqemlnyvlspfyyyqveawkthvwq
    d
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ej8B (B:)
    prhvriknwgsgmtfqdtlhhkakgiltcrsksclgsimtpksltrgprdkptppdellp
    qaiefvnqyygsfkeakieehlarveavtkeiettgtyqltgdelifatkqawrnaprci
    griqwsnlqvfdarscstaremfehicrhvrystnngnirsaitvfpqrsdgkhdfrvwn
    aqliryagyqmpdgsirgdpanveitqlcidlgwkpkygrfdvlplvlqangrdpelfei
    ppdlvlevamehpkyewfrelelkwyalpavanmllevgglefpgcpfngwymgteigvr
    dfcdvqrynileevgrrmglethklaslwkdqavveiniavlhsfqkqnvtimdhhsaae
    sfmkymqneyrsrggcpadwiwlvppmsgsitpvfhqemlnyvlspfyyyqveawkthvw
    qdek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ej8B (B:)
    rhvriknwgsgmtfqdtlhhkakgiltcrsksclgsimtpksltrgprdkptppdellpq
    aiefvnqyygsfkeakieehlarveavtkeiettgtyqltgdelifatkqawrnaprcig
    riqwsnlqvfdarscstaremfehicrhvrystnngnirsaitvfpqrsdgkhdfrvwna
    qliryagyqmpdgsirgdpanveitqlcidlgwkpkygrfdvlplvlqangrdpelfeip
    pdlvlevamehpkyewfrelelkwyalpavanmllevgglefpgcpfngwymgteigvrd
    fcdvqrynileevgrrmglethklaslwkdqavveiniavlhsfqkqnvtimdhhsaaes
    fmkymqneyrsrggcpadwiwlvppmsgsitpvfhqemlnyvlspfyyyqveawkthvwq
    d
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ej8C (C:)
    prhvriknwgsgmtfqdtlhhkakgiltcrsksclgsimtpksltrgprdkptppdellp
    qaiefvnqyygsfkeakieehlarveavtkeiettgtyqltgdelifatkqawrnaprci
    griqwsnlqvfdarscstaremfehicrhvrystnngnirsaitvfpqrsdgkhdfrvwn
    aqliryagyqmpdgsirgdpanveitqlcidlgwkpkygrfdvlplvlqangrdpelfei
    ppdlvlevamehpkyewfrelelkwyalpavanmllevgglefpgcpfngwymgteigvr
    dfcdvqrynileevgrrmglethklaslwkdqavveiniavlhsfqkqnvtimdhhsaae
    sfmkymqneyrsrggcpadwiwlvppmsgsitpvfhqemlnyvlspfyyyqveawkthvw
    qdek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ej8C (C:)
    rhvriknwgsgmtfqdtlhhkakgiltcrsksclgsimtpksltrgprdkptppdellpq
    aiefvnqyygsfkeakieehlarveavtkeiettgtyqltgdelifatkqawrnaprcig
    riqwsnlqvfdarscstaremfehicrhvrystnngnirsaitvfpqrsdgkhdfrvwna
    qliryagyqmpdgsirgdpanveitqlcidlgwkpkygrfdvlplvlqangrdpelfeip
    pdlvlevamehpkyewfrelelkwyalpavanmllevgglefpgcpfngwymgteigvrd
    fcdvqrynileevgrrmglethklaslwkdqavveiniavlhsfqkqnvtimdhhsaaes
    fmkymqneyrsrggcpadwiwlvppmsgsitpvfhqemlnyvlspfyyyqveawkthvwq
    d
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ej8D (D:)
    prhvriknwgsgmtfqdtlhhkakgiltcrsksclgsimtpksltrgprdkptppdellp
    qaiefvnqyygsfkeakieehlarveavtkeiettgtyqltgdelifatkqawrnaprci
    griqwsnlqvfdarscstaremfehicrhvrystnngnirsaitvfpqrsdgkhdfrvwn
    aqliryagyqmpdgsirgdpanveitqlcidlgwkpkygrfdvlplvlqangrdpelfei
    ppdlvlevamehpkyewfrelelkwyalpavanmllevgglefpgcpfngwymgteigvr
    dfcdvqrynileevgrrmglethklaslwkdqavveiniavlhsfqkqnvtimdhhsaae
    sfmkymqneyrsrggcpadwiwlvppmsgsitpvfhqemlnyvlspfyyyqveawkthvw
    qdek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ej8D (D:)
    rhvriknwgsgmtfqdtlhhkakgiltcrsksclgsimtpksltrgprdkptppdellpq
    aiefvnqyygsfkeakieehlarveavtkeiettgtyqltgdelifatkqawrnaprcig
    riqwsnlqvfdarscstaremfehicrhvrystnngnirsaitvfpqrsdgkhdfrvwna
    qliryagyqmpdgsirgdpanveitqlcidlgwkpkygrfdvlplvlqangrdpelfeip
    pdlvlevamehpkyewfrelelkwyalpavanmllevgglefpgcpfngwymgteigvrd
    fcdvqrynileevgrrmglethklaslwkdqavveiniavlhsfqkqnvtimdhhsaaes
    fmkymqneyrsrggcpadwiwlvppmsgsitpvfhqemlnyvlspfyyyqveawkthvwq
    d