PDB entry 3ej1

View 3ej1 on RCSB PDB site
Description: CDK2/CyclinA complexed with a pyrazolopyridazine inhibitor
Class: Transferase/Cell cycle
Keywords: cdk, cyclin, kinase, ATP-binding, Cell cycle, Cell division, Mitosis, Nucleotide-binding, Phosphoprotein, Serine/threonine-protein kinase, Transferase, Nucleus, Transferase-Cell cycle COMPLEX
Deposited on 2008-09-17, released 2008-10-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.22 Å
R-factor: 0.221
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell division protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK2
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Cyclin-A2
    Species: Homo sapiens [TaxId:9606]
    Gene: CCNA2, CCN1, CCNA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ej1b1, d3ej1b2
  • Chain 'C':
    Compound: Cell division protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK2
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Cyclin-A2
    Species: Homo sapiens [TaxId:9606]
    Gene: CCNA2, CCN1, CCNA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ej1d1, d3ej1d2
  • Heterogens: 5BP

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ej1B (B:)
    nevpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetl
    hlavnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvl
    rmehlvlkvltfdlaaptvnqfltqyflhqqpanckveslamflgelslidadpylkylp
    sviagaafhlalytvtgqswpeslirktgytleslkpclmdlhqtylkapqhaqqsirek
    yknskyhgvsllnppetlnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ej1B (B:)
    vpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhl
    avnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrm
    ehlvlkvltfdlaaptvnqfltqyflhqqpanckveslamflgelslidadpylkylpsv
    iagaafhlalytvtgqswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyk
    nskyhgvsllnppetlnl
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ej1D (D:)
    nevpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetl
    hlavnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvl
    rmehlvlkvltfdlaaptvnqfltqyflhqqpanckveslamflgelslidadpylkylp
    sviagaafhlalytvtgqswpeslirktgytleslkpclmdlhqtylkapqhaqqsirek
    yknskyhgvsllnppetlnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ej1D (D:)
    pdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhla
    vnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrme
    hlvlkvltfdlaaptvnqfltqyflhqqpanckveslamflgelslidadpylkylpsvi
    agaafhlalytvtgqswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekykn
    skyhgvsllnppetlnl