PDB entry 3eip

View 3eip on RCSB PDB site
Description: crystal structure of colicin e3 immunity protein: an inhibitor to a ribosome-inactivating RNAse
Class: immune system
Keywords: ribonuclease inhibitor, colicin
Deposited on 1999-03-29, released 1999-11-10
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.218
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (colicin e3 immunity protein)
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02984 (0-83)
  Domains in SCOP 1.75: d3eipa_
• Chain 'B':
  Compound: protein (colicin e3 immunity protein)
  Species: Escherichia coli
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02984 (0-83)
  Domains in SCOP 1.75: d3eipb_
• Heterogens: ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3eipA (A:)
  glkldltwfdkstedfkgeeyskdfgddgsvmeslgvpfkdnvnngcfdviaewvpllqp
  yfnhqidisdneyfvsfdyrdgdw
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3eipB (B:)
  glkldltwfdkstedfkgeeyskdfgddgsvmeslgvpfkdnvnngcfdviaewvpllqp
  yfnhqidisdneyfvsfdyrdgdw