PDB entry 3eip

View 3eip on RCSB PDB site
Description: crystal structure of colicin e3 immunity protein: an inhibitor to a ribosome-inactivating rnase
Deposited on 1999-03-29, released 1999-11-10
The last revision prior to the SCOP 1.69 freeze date was dated 2000-06-30, with a file datestamp of 2000-06-30.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.218
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d3eipa_
  • Chain 'B':
    Domains in SCOP 1.69: d3eipb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3eipA (A:)
glkldltwfdkstedfkgeeyskdfgddgsvmeslgvpfkdnvnngcfdviaewvpllqp
yfnhqidisdneyfvsfdyrdgdw

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3eipB (B:)
glkldltwfdkstedfkgeeyskdfgddgsvmeslgvpfkdnvnngcfdviaewvpllqp
yfnhqidisdneyfvsfdyrdgdw