SCOPe 2.06: Structural Classification of Proteins

PDB entry 3eic

View 3eic on RCSB PDB site
Description: X-ray structure of Acanthamoeba ployphaga mimivirus nucleoside diphosphate kinase complexed with UDP
Class: transferase
Keywords: NDK Phosphotransferase nucleotide binding, ATP-binding, Kinase, Magnesium, Metal-binding, Nucleotide metabolism, Nucleotide-binding, Phosphoprotein, Transferase
Deposited on 2008-09-15, released 2009-06-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.19
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Nucleoside diphosphate kinase
Species: Acanthamoeba polyphaga mimivirus [TaxId:212035]
Gene: NDK, MIMI_R418
Database cross-references and differences (RAF-indexed):
- Uniprot Q5UQL3 (6-End)
  - expression tag (3-5)
Domains in SCOPe 2.06: d3eica1, d3eica2
Chain 'B':
Compound: Nucleoside diphosphate kinase
Species: Acanthamoeba polyphaga mimivirus [TaxId:212035]
Gene: NDK, MIMI_R418
Database cross-references and differences (RAF-indexed):
- Uniprot Q5UQL3 (6-End)
  - expression tag (5)
Domains in SCOPe 2.06: d3eicb1, d3eicb2
Chain 'C':
Compound: Nucleoside diphosphate kinase
Species: Acanthamoeba polyphaga mimivirus [TaxId:212035]
Gene: NDK, MIMI_R418
Database cross-references and differences (RAF-indexed):
- Uniprot Q5UQL3 (6-End)
  - expression tag (4-5)
Domains in SCOPe 2.06: d3eicc1, d3eicc2
Chain 'D':
Compound: Nucleoside diphosphate kinase
Species: Acanthamoeba polyphaga mimivirus [TaxId:212035]
Gene: NDK, MIMI_R418
Database cross-references and differences (RAF-indexed):
- Uniprot Q5UQL3 (6-End)
  - expression tag (4-5)
Domains in SCOPe 2.06: d3eicd1, d3eicd2
Chain 'E':
Compound: Nucleoside diphosphate kinase
Species: Acanthamoeba polyphaga mimivirus [TaxId:212035]
Gene: NDK, MIMI_R418
Database cross-references and differences (RAF-indexed):
- Uniprot Q5UQL3 (6-End)
  - expression tag (4-5)
Domains in SCOPe 2.06: d3eice1, d3eice2
Chain 'F':
Compound: Nucleoside diphosphate kinase
Species: Acanthamoeba polyphaga mimivirus [TaxId:212035]
Gene: NDK, MIMI_R418
Database cross-references and differences (RAF-indexed):
- Uniprot Q5UQL3 (6-End)
  - expression tag (4-5)
Domains in SCOPe 2.06: d3eicf1, d3eicf2
Heterogens: MG, UDP, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>3eicA (A:)
ykkaglqrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehse
qsyfndncdfmvsgpiisivyegtdaiskirrlqgniltpgtirgdlandirenlihasd
sedsavdeisiwfpetkmetdn