PDB entry 3eia

View 3eia on RCSB PDB site
Description: Crystal structure of K270Q variant of LL-diaminopimelate aminotransferase from Arabidopsis thaliana complexed with L-Glu: External aldimine form
Class: transferase
Keywords: aminotransferase, lysine biosynthesis, Pyridoxal 5' phosphate, external aldimine, LL-diaminopimelate, Chloroplast, Plastid, Pyridoxal phosphate, Transferase, Transit peptide
Deposited on 2008-09-15, released 2008-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.188
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: LL-diaminopimelate aminotransferase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: DAP, AGD2, At4g33680, T16L1.170
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93ZN9 (Start-425)
      • engineered (269)
      • expression tag (426-429)
    Domains in SCOPe 2.07: d3eiaa1, d3eiaa2
  • Chain 'B':
    Compound: LL-diaminopimelate aminotransferase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: DAP, AGD2, At4g33680, T16L1.170
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93ZN9 (Start-425)
      • engineered (269)
      • expression tag (426)
    Domains in SCOPe 2.07: d3eiab1, d3eiab2
  • Heterogens: SO4, PL6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3eiaA (A:)
    makrvntckcvatpqekieyktkvsrnsnmsklqagylfpeiarrrsahllkypdaqvis
    lgigdttepipevitsamakkahelstiegysgygaeqgakplraaiaktfygglgigdd
    dvfvsdgakcdisrlqvmfgsnvtiavqdpsypayvdssvimgqtgqfntdvqkygniey
    mrctpengffpdlstvgrtdiiffcspnnptgaaatreqltqlvefakkngsiivydsay
    amymsddnprsifeipgaeevametasfsqyagftgvrlgwtvipkkllysdgfpvakdf
    nriictcfngasnisqagalacltpegleamhkvigfykentniiidtftslgydvyggk
    napyvwvhfpnqsswdvfaeilekthvvttpgsgfgpggegfvrvsafghrenileacrr
    fkqlykhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eiaA (A:)
    eyktkvsrnsnmsklqagylfpeiarrrsahllkypdaqvislgigdttepipevitsam
    akkahelstiegysgygaeqgakplraaiaktfygglgigdddvfvsdgakcdisrlqvm
    fgsnvtiavqdpsypayvdssvimgqtgqfntdvqkygnieymrctpengffpdlstvgr
    tdiiffcspnnptgaaatreqltqlvefakkngsiivydsayamymsddnprsifeipga
    eevametasfsqyagftgvrlgwtvipkkllysdgfpvakdfnriictcfngasnisqag
    alacltpegleamhkvigfykentniiidtftslgydvyggknapyvwvhfpnqsswdvf
    aeilekthvvttpgsgfgpggegfvrvsafghrenileacrrfkqlykhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3eiaB (B:)
    makrvntckcvatpqekieyktkvsrnsnmsklqagylfpeiarrrsahllkypdaqvis
    lgigdttepipevitsamakkahelstiegysgygaeqgakplraaiaktfygglgigdd
    dvfvsdgakcdisrlqvmfgsnvtiavqdpsypayvdssvimgqtgqfntdvqkygniey
    mrctpengffpdlstvgrtdiiffcspnnptgaaatreqltqlvefakkngsiivydsay
    amymsddnprsifeipgaeevametasfsqyagftgvrlgwtvipkkllysdgfpvakdf
    nriictcfngasnisqagalacltpegleamhkvigfykentniiidtftslgydvyggk
    napyvwvhfpnqsswdvfaeilekthvvttpgsgfgpggegfvrvsafghrenileacrr
    fkqlykhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eiaB (B:)
    eyktkvsrnsnmsklqagylfpeiarrrsahllkypdaqvislgigdttepipevitsam
    akkahelstiegysgygaeqgakplraaiaktfygglgigdddvfvsdgakcdisrlqvm
    fgsnvtiavqdpsypayvdssvimgqtgqfntdvqkygnieymrctpengffpdlstvgr
    tdiiffcspnnptgaaatreqltqlvefakkngsiivydsayamymsddnprsifeipga
    eevametasfsqyagftgvrlgwtvipkkllysdgfpvakdfnriictcfngasnisqag
    alacltpegleamhkvigfykentniiidtftslgydvyggknapyvwvhfpnqsswdvf
    aeilekthvvttpgsgfgpggegfvrvsafghrenileacrrfkqlykh