PDB entry 3ei5

View 3ei5 on RCSB PDB site
Description: Crystal structure of LL-diaminopimelate aminotransferase from Arabidopsis thaliana complexed with PLP-Glu: an external aldimine mimic
Class: transferase
Keywords: aminotransferase, lysine biosynthesis, Pyridoxal 5' phosphate, external aldimine, LL-diaminopimelate, Chloroplast, Pyridoxal phosphate, Transferase, Transit peptide
Deposited on 2008-09-15, released 2008-10-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.173
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: LL-diaminopimelate aminotransferase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: DAP, AGD2, At4g33680, T16L1.170
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ei5a_
  • Chain 'B':
    Compound: LL-diaminopimelate aminotransferase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: DAP, AGD2, At4g33680, T16L1.170
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93ZN9 (Start-425)
      • expression tag (426-427)
  • Heterogens: PGU, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ei5A (A:)
    makrvntckcvatpqekieyktkvsrnsnmsklqagylfpeiarrrsahllkypdaqvis
    lgigdttepipevitsamakkahelstiegysgygaeqgakplraaiaktfygglgigdd
    dvfvsdgakcdisrlqvmfgsnvtiavqdpsypayvdssvimgqtgqfntdvqkygniey
    mrctpengffpdlstvgrtdiiffcspnnptgaaatreqltqlvefakkngsiivydsay
    amymsddnprsifeipgaeevametasfskyagftgvrlgwtvipkkllysdgfpvakdf
    nriictcfngasnisqagalacltpegleamhkvigfykentniiidtftslgydvyggk
    napyvwvhfpnqsswdvfaeilekthvvttpgsgfgpggegfvrvsafghrenileacrr
    fkqlykhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ei5A (A:)
    eyktkvsrnsnmsklqagylfpeiarrrsahllkypdaqvislgigdttepipevitsam
    akkahelstiegysgygaeqgakplraaiaktfygglgigdddvfvsdgakcdisrlqvm
    fgsnvtiavqdpsypayvdssvimgqtgqfntdvqkygnieymrctpengffpdlstvgr
    tdiiffcspnnptgaaatreqltqlvefakkngsiivydsayamymsddnprsifeipga
    eevametasfskyagftgvrlgwtvipkkllysdgfpvakdfnriictcfngasnisqag
    alacltpegleamhkvigfykentniiidtftslgydvyggknapyvwvhfpnqsswdvf
    aeilekthvvttpgsgfgpggegfvrvsafghrenileacrrfkqlyk
    

  • Chain 'B':
    No sequence available.