PDB entry 3ehn

View 3ehn on RCSB PDB site
Description: BT1043 with N-acetyllactosamine
Class: sugar binding protein
Keywords: SusD homolog, glycan-binding, mucin O-glycan, tetratrico-peptide repeat, SUGAR BINDING PROTEIN
Deposited on 2008-09-13, released 2009-05-12
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-05-12, with a file datestamp of 2009-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.196
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SusD homolog
    Species: Bacteroides thetaiotaomicron [TaxId:818]
    Gene: BT1043, BT_1043
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8A8X4 (Start-531)
      • conflict (211)
    Domains in SCOPe 2.04: d3ehna_
  • Chain 'B':
    Compound: SusD homolog
    Species: Bacteroides thetaiotaomicron [TaxId:818]
    Gene: BT1043, BT_1043
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8A8X4
      • conflict (211)
    Domains in SCOPe 2.04: d3ehnb_
  • Heterogens: NLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ehnA (A:)
    masdyeavntnpygvsdgelgplkygarfmnmqqrvipigspslttgpgndlqntdliss
    gnyigyfgnnnnwgfnneanwnftdsrmnyayqnfysqiflpwneiyeiakdsdspseqa
    ileianivrniawlratdvfgpiaynsagdgsiapkfdsqevvyrsmladlsksvellnt
    isysvmaqydliyngnvqnwvklanslmlrivvrvhfidetlakeyitkaldpknggvie
    disseakikssdkmpllnsmlasvneynetrmgatiwgyldgykdprlsayftegtygsg
    swaqtgyfpvaptnsksksetsysakfasrpkvdsnsplywfrasetyflkaeaalynli
    ggdpktfyeqginisfqeqgvsgvatylsgtgkptgltgsnykygtynhdlsigntspkw
    ddytgnlskqeeqlqkiitqkylalypnaveawteyrrtgfpylmkpmdeaapgrigasi
    edcrvperfrfaptaynsnpnmaeiptllgggdigatklwwvrsnrpkqpnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ehnA (A:)
    elgplkygarfmnmqqrvipigspslttgpgndlqntdlissgnyigyfgnnnnwgfnne
    anwnftdsrmnyayqnfysqiflpwneiyeiakdsdspseqaileianivrniawlratd
    vfgpiaynsagdgsiapkfdsqevvyrsmladlsksvellntisysvmaqydliyngnvq
    nwvklanslmlrivvrvhfidetlakeyitkaldpknggviedisseakikssdkmplln
    smlasvneynetrmgatiwgyldgykdprlsayftegtygsgswaqtgyfpvaptnsksk
    setsysakfasrpkvdsnsplywfrasetyflkaeaalynliggdpktfyeqginisfqe
    qgvsgvatylsgtgkptgltgsnykygtynhdlsigntspkwddytgnlskqeeqlqkii
    tqkylalypnaveawteyrrtgfpylmkpmdeaapgrigasiedcrvperfrfaptayns
    npnmaeiptllgggdigatklwwvrsnrpkqpnq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ehnB (B:)
    masdyeavntnpygvsdgelgplkygarfmnmqqrvipigspslttgpgndlqntdliss
    gnyigyfgnnnnwgfnneanwnftdsrmnyayqnfysqiflpwneiyeiakdsdspseqa
    ileianivrniawlratdvfgpiaynsagdgsiapkfdsqevvyrsmladlsksvellnt
    isysvmaqydliyngnvqnwvklanslmlrivvrvhfidetlakeyitkaldpknggvie
    disseakikssdkmpllnsmlasvneynetrmgatiwgyldgykdprlsayftegtygsg
    swaqtgyfpvaptnsksksetsysakfasrpkvdsnsplywfrasetyflkaeaalynli
    ggdpktfyeqginisfqeqgvsgvatylsgtgkptgltgsnykygtynhdlsigntspkw
    ddytgnlskqeeqlqkiitqkylalypnaveawteyrrtgfpylmkpmdeaapgrigasi
    edcrvperfrfaptaynsnpnmaeiptllgggdigatklwwvrsnrpkqpnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ehnB (B:)
    lgplkygarfmnmqqrvipigspslttgpgndlqntdlissgnyigyfgnnnnwgfnnea
    nwnftdsrmnyayqnfysqiflpwneiyeiakdsdspseqaileianivrniawlratdv
    fgpiaynsagdgsiapkfdsqevvyrsmladlsksvellntisysvmaqydliyngnvqn
    wvklanslmlrivvrvhfidetlakeyitkaldpknggviedisseakikssdkmpllns
    mlasvneynetrmgatiwgyldgykdprlsayftegtygsgswaqtgyfpvaptnsksks
    etsysakfasrpkvdsnsplywfrasetyflkaeaalynliggdpktfyeqginisfqeq
    gvsgvatylsgtgkptgltgsnykygtynhdlsigntspkwddytgnlskqeeqlqkiit
    qkylalypnaveawteyrrtgfpylmkpmdeaapgrigasiedcrvperfrfaptaynsn
    pnmaeiptllgggdigatklwwvrsnrpkqpn