PDB entry 3ehe

View 3ehe on RCSB PDB site
Description: Crystal structure of UDP-glucose 4 epimerase (galE-1) from Archaeoglobus fulgidus
Class: isomerase
Keywords: PSI-II, NYSGXRC, 11140g, galE-1, UDP-glucose 4 epimerase, Structural Genomics, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, ISOMERASE
Deposited on 2008-09-12, released 2008-10-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-02-09, with a file datestamp of 2011-02-04.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.253
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UDP-glucose 4-epimerase (GalE-1)
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF_0361
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29886 (Start-304)
      • expression tag (2)
      • expression tag (122)
    Domains in SCOPe 2.05: d3ehea_
  • Chain 'B':
    Compound: UDP-glucose 4-epimerase (GalE-1)
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF_0361
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29886 (Start-304)
      • expression tag (2)
      • expression tag (122)
    Domains in SCOPe 2.05: d3eheb_
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3eheA (A:)
    mslivvtggagfigshvvdklsesneivvidnlssgneefvneaarlvkadlaaddikdy
    lkgaeevwhiaanpdvrigaenpdeiyrnnvlatyrlleamrkagvsrivftststvyge
    akviptpedypthpislygasklacealiesychtfdmqawiyrfanvigrrsthgviyd
    fimklkrnpeeleilgngeqnksyiyisdcvdamlfglrgdervnifnigsedqikvkri
    aeivceelglsprfrftggdrgwkgdvpvmllsieklkrlgwkprynseeavrmavrdlv
    edldeeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eheA (A:)
    livvtggagfigshvvdklsesneivvidnlssgneefvneaarlvkadlaaddikdylk
    gaeevwhiaanpdvrgaenpdeiyrnnvlatyrlleamrkagvsrivftststvygeakv
    iptpedypthpislygasklacealiesychtfdmqawiyrfanvigrrsthgviydfim
    klkrnpeeleilgngeqnksyiyisdcvdamlfglrgdervnifnigsedqikvkriaei
    vceelglsprfrftmllsieklkrlgwkprynseeavrmavrdlvedlde
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3eheB (B:)
    mslivvtggagfigshvvdklsesneivvidnlssgneefvneaarlvkadlaaddikdy
    lkgaeevwhiaanpdvrigaenpdeiyrnnvlatyrlleamrkagvsrivftststvyge
    akviptpedypthpislygasklacealiesychtfdmqawiyrfanvigrrsthgviyd
    fimklkrnpeeleilgngeqnksyiyisdcvdamlfglrgdervnifnigsedqikvkri
    aeivceelglsprfrftggdrgwkgdvpvmllsieklkrlgwkprynseeavrmavrdlv
    edldeeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eheB (B:)
    livvtggagfigshvvdklsesneivvidnlssgneefvneaarlvkadlaaddikdylk
    gaeevwhiaanpdvrgaenpdeiyrnnvlatyrlleamrkagvsrivftststvygeakv
    iptpedypthpislygasklacealiesychtfdmqawiyrfanvigrrsthgviydfim
    klkrnpeeleilgngeqnksyiyisdcvdamlfglrgdervnifnigsedqikvkriaei
    vceelglsprfrftmllsieklkrlgwkprynseeavrmavrdlvedlde