PDB entry 3eha

View 3eha on RCSB PDB site
Description: Crystal structure of death associated protein kinase complexed with AMPPNP
Class: transferase
Keywords: kinase domain S/T kinase, ANK repeat, Apoptosis, ATP-binding, Calmodulin-binding, Cytoplasm, Kinase, Nucleotide-binding, Phosphoprotein, Polymorphism, Serine/threonine-protein kinase, Transferase
Deposited on 2008-09-11, released 2009-04-28
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-04-28, with a file datestamp of 2009-04-24.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.18
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Death-associated protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: DAPK1, DAPK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53355 (0-End)
      • expression tag (289-292)
    Domains in SCOPe 2.04: d3ehaa_
  • Heterogens: ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ehaA (A:)
    tvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsredi
    erevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeateflk
    qilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgtp
    efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedeyf
    sntsalakdfirrllvkdpkkrmtiqdslqhpwikpkdtqqalssawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ehaA (A:)
    tvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsredi
    erevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekslteeeateflkq
    ilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgtpe
    fvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedeyfs
    ntsalakdfirrllvkdpkkrmtiqdslqhpwikppqfe