PDB entry 3egw

View 3egw on RCSB PDB site
Description: The crystal structure of the NarGHI mutant NarH - C16A
Class: oxidoreductase
Keywords: OXIDOREDUCTASE, nitrate reduction, electron transfer, membrane protein, 4Fe-4S, Cell membrane, Electron transport, Iron, Iron-sulfur, Membrane, Metal-binding, Molybdenum, Nitrate assimilation, Transport, 3Fe-4S, Cell inner membrane, Formylation, Heme, Transmembrane
Deposited on 2008-09-11, released 2010-03-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-03-02, with a file datestamp of 2010-02-26.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.175
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Respiratory nitrate reductase 1 alpha chain
    Species: Escherichia coli [TaxId:83333]
    Gene: narG, bisD, narC, b1224, JW1215
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09152 (0-1243)
      • conflict (9)
      • conflict (361)
    Domains in SCOPe 2.04: d3egwa1, d3egwa2
  • Chain 'B':
    Compound: Respiratory nitrate reductase 1 beta chain
    Species: Escherichia coli [TaxId:83333]
    Gene: narH, b1225, JW1216
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11349 (0-508)
      • engineered (15)
    Domains in SCOPe 2.04: d3egwb_
  • Chain 'C':
    Compound: Respiratory nitrate reductase 1 gamma chain
    Species: Escherichia coli [TaxId:83333]
    Gene: narI, chlI, b1227, JW1218
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11350 (0-224)
      • conflict (76-77)
    Domains in SCOPe 2.04: d3egwc_
  • Heterogens: MD1, MGD, 6MO, SF4, F3S, 3PH, HEM, AGA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3egwA (A:)
    skfldrfryakqkgetfadghgqllntnrdwedgyrqrwqhdkivrsthgvnctgscswk
    iyvknglvtwetqqtdyprtrpdlpnheprgcprgasyswylysanrlkypmmrkrlmkm
    wreakalhsdpveawasiiedadkaksfkqargrggfvrsswqevneliaasnvytikny
    gpdrvagfspipamsmvsyasgarylsliggtclsfydwycdlppaspqtwgeqtdvpes
    adwynssyiiawgsnvpqtrtpdahfftevrykgtktvavtpdyaeiaklcdlwlapkqg
    tdaamalamghvmlrefhldnpsqyftdyvrrytdmpmlvmleerdgyyaagrmlraadl
    vaalgqennpewktvafntngemvapngsigfrwgekgkwnleqrdgktgeetelqlsll
    gsqdeiaevgfpyfggdgtehfnkvelenvllhklpvkrlqladgstalvttvydltlan
    yglerglndvncatsyddvkaytpawaeqitgvsrsqiiriarefadnadkthgrsmiiv
    gaglnhwyhldmnyrglinmlifcgcvgqsgggwahyvgqeklrpqtgwqplafaldwqr
    parhmnstsyfynhssqwryetvtaeellspmadksrytghlidfnvraermgwlpsapq
    lgtnpltiageaekagmnpvdytvkslkegsirfaaeqpengknhprnlfiwrsnllgss
    gkghefmlkyllgtehgiqgkdlgqqggvkpeevdwqdnglegkldlvvtldfrlsstcl
    ysdiilptatwyekddmntsdmhpfihplsaavdpaweaksdweiykaiakkfsevcvgh
    lgketdivtlpiqhdsaaelaqpldvkdwkkgecdlipgktaphimvverdypatyerft
    sigplmekignggkgiawntqsemdllrklnytkaegpakgqpmlntaidaaemiltlap
    etngqvavkawaalseftgrdhthlalnkedekirfrdiqaqprkiissptwsgledehv
    synagytnvhelipwrtlsgrqqlyqdhqwmrdfgesllvyrppidtrsvkevigqksng
    nqekalnfltphqkwgihstysdnllmltlgrggpvvwlseadakdlgiadndwievfns
    ngaltaravvsqrvpagmtmmyhaqerivnlpgseitqqrggihnsvtritpkpthmigg
    yahlaygfnyygtvgsnrdefvvvrkmknidwldgegndqvqes
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3egwB (B:)
    mkirsqvgmvlnldkaigchtcsvtcknvwtsregveyawfnnvetkpgqgfptdwenqe
    kykggwirkingklqprmgnramllgkifanphlpgiddyyepfdfdyqnlhtapegsks
    qpiarprslitgermakiekgpnweddlggefdklakdknfdniqkamysqfentfmmyl
    prlcehclnpacvatcpsgaiykreedgivlidqdkcrgwrmcitgcpykkiyfnwksgk
    sekcifcyprieagqptvcsetcvgrirylgvllydadaieraastenekdlyqrqldvf
    ldpndpkvieqaikdgiplsvieaaqqspvykmamewklalplhpeyrtlpmvwyvppls
    piqsaadagelgsngilpdveslripvqylanlltagdtkpvlralkrmlamrhykraet
    vdgkvdtraleevglteaqaqemyrylaianyedrfvvpsshrelareafpekngcgftf
    gdgchgsdtkfnlfnsrridaidvtskte
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3egwC (C:)
    mqflnmfffdiypyiagavfligswlrydygqytwraassqmldrkgmnlasnlfhigil
    gifvghffgmltphwmaaawlpievkqkmamfaggasgvlcliggvlllkrrlfsprvra
    tttgadililsllviqcalglltipfsaqhmdgsemmklvgwaqsvvtfhggasqhldgv
    afifrlhlvlgmtlfllfpfsrlihiwsvpveyltrkyqlvrarh