PDB entry 3egv

View 3egv on RCSB PDB site
Description: Ribosomal protein L11 methyltransferase (PrmA) in complex with trimethylated ribosomal protein L11
Class: transferase/ribosomal protein
Keywords: post-translational modification, multiple methyltransferase, Cytoplasm, Methyltransferase, Transferase, Methylation, Ribonucleoprotein, Ribosomal protein, RNA-binding, rRNA-binding, TRANSFERASE/RIBOSOMAL PROTEIN COMPLEX
Deposited on 2008-09-11, released 2008-09-23
The last revision prior to the SCOP 1.75 freeze date was dated 2008-09-23, with a file datestamp of 2008-09-19.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.184
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribosomal protein L11 methyltransferase
    Species: Thermus thermophilus [TaxId:300852]
    Gene: prmA, TTHA0656
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3egva1
  • Chain 'B':
    Compound: 50S ribosomal protein L11
    Species: Thermus thermophilus [TaxId:274]
    Gene: rplK, rpl11
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36238 (0-End)
      • engineered (14)
    Domains in SCOP 1.75: d3egvb1
  • Heterogens: SAH, GOL, CL, 4MM, IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3egvA (A:)
    mwvyrlkgtlealdpilpglfdggarglweregevwaffpapvdlpyegvweevgdedwl
    eawrrdlkpalappfvvlapwhtwegaeiplviepgmafgtghhettrlalkalarhlrp
    gdkvldlgtgsgvlaiaaeklggkalgvdidpmvlpqaeanakrngvrprflegsleaal
    pfgpfdllvanlyaelhaalapryrealvpggralltgilkdraplvreamagagfrple
    eaaegewvllaygr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3egvB (B:)
    kkvvavvklqlpagaatpappvgpalgqhganimefvkafnaatanmgdaivpveitiya
    drsftfvtktppasylirkaaglekgahkpgrekvgritweqvleiakqkmpdlnttdle
    aaarmiagsarsmgvevvgapevkda
    

    Sequence, based on observed residues (ATOM records): (download)
    >3egvB (B:)
    kkvvavvklqlpagaatpappvgpalgqhganimefvkafnaatanmgdaivpveitiya
    drsftfvtktppasyli