PDB entry 3egv

View 3egv on RCSB PDB site
Description: Ribosomal protein L11 methyltransferase (PrmA) in complex with trimethylated ribosomal protein L11
Class: transferase/ribosomal protein
Keywords: post-translational modification, multiple methyltransferase, Methyltransferase, Transferase, Methylation, Ribonucleoprotein, Ribosomal protein, RNA-binding, rRNA-binding, TRANSFERASE-RIBOSOMAL PROTEIN COMPLEX
Deposited on 2008-09-11, released 2008-09-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-03-01, with a file datestamp of 2017-02-24.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribosomal protein L11 methyltransferase
    Species: Thermus thermophilus HB8 [TaxId:300852]
    Gene: prmA, TTHA0656
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3egva1
  • Chain 'B':
    Compound: 50S ribosomal protein L11
    Species: Thermus thermophilus HB8 [TaxId:300852]
    Gene: rpl11, rplK, TTHA0247
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SLP6 (0-End)
      • engineered mutation (15)
    Domains in SCOPe 2.08: d3egvb1
  • Heterogens: SAH, GOL, CL, IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3egvA (A:)
    mwvyrlkgtlealdpilpglfdggarglweregevwaffpapvdlpyegvweevgdedwl
    eawrrdlkpalappfvvlapwhtwegaeiplviepgmafgtghhettrlalkalarhlrp
    gdkvldlgtgsgvlaiaaeklggkalgvdidpmvlpqaeanakrngvrprflegsleaal
    pfgpfdllvanlyaelhaalapryrealvpggralltgilkdraplvreamagagfrple
    eaaegewvllaygr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3egvB (B:)
    xkkvvavvklqlpagaatpappvgpalgqhganimefvkafnaatanmgdaivpveitiy
    adrsftfvtktppasylirkaaglekgahkpgrekvgritweqvleiakqkmpdlnttdl
    eaaarmiagsarsmgvevvgapevkda
    

    Sequence, based on observed residues (ATOM records): (download)
    >3egvB (B:)
    xkkvvavvklqlpagaatpappvgpalgqhganimefvkafnaatanmgdaivpveitiy
    adrsftfvtktppasyli