PDB entry 3egu

View 3egu on RCSB PDB site
Description: Crystal structure of the N114A mutant of ABL-SH3 domain
Class: transferase
Keywords: beta, ATP-binding, Cell adhesion, Cytoskeleton, Kinase, Lipoprotein, Magnesium, Manganese, Metal-binding, Myristate, Nucleotide-binding, Nucleus, Phosphoprotein, Proto-oncogene, SH2 domain, SH3 domain, Transferase, Tyrosine-protein kinase
Deposited on 2008-09-11, released 2009-09-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.222
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Proto-oncogene tyrosine-protein kinase ABL1
  Species: Homo sapiens [TaxId:9606]
  Gene: ABL1, ABL, JTK7
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00519
    • engineered (55)
  Domains in SCOPe 2.05: d3egua_
• Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3eguA (A:)
  mendpnlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsayitp
  vns
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3eguA (A:)
  pnlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsayitpv