PDB entry 3egu

View 3egu on RCSB PDB site
Description: Crystal structure of the N114A mutant of ABL-SH3 domain
Class: transferase
Keywords: beta, ATP-binding, Cell adhesion, Cytoskeleton, Kinase, Lipoprotein, Magnesium, Manganese, Metal-binding, Myristate, Nucleotide-binding, Nucleus, Phosphoprotein, Proto-oncogene, SH2 domain, SH3 domain, Transferase, Tyrosine-protein kinase
Deposited on 2008-09-11, released 2009-09-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase ABL1
    Species: Homo sapiens [TaxId:9606]
    Gene: ABL1, ABL, JTK7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00519
      • engineered (55)
    Domains in SCOPe 2.08: d3egua_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3eguA (A:)
    mendpnlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsayitp
    vns
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eguA (A:)
    pnlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsayitpv