PDB entry 3eg4

View 3eg4 on RCSB PDB site
Description: Crystal structure of 2,3,4,5-Tetrahydropyridine-2-carboxylate N-Succinyltransferase from Brucella melitensis biovar abortus 2308
Class: transferase
Keywords: SSGCID, TRANSFERASE, N-SUCCINYL-TRANSFERASE, BETA HELIX, Acyltransferase, Amino-acid biosynthesis, Cytoplasm, Diaminopimelate biosynthesis, Lysine biosynthesis, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease
Deposited on 2008-09-10, released 2008-09-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.132
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
    Species: Brucella suis [TaxId:29461]
    Gene: dapD, BRA1028
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3eg4a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3eg4A (A:)
    mahhhhhhmgtleaqtqgpsmtkpdlaslektiekafderdgintatrgevreaveqsli
    lldrgevrvaekqadgnwhvnqwlkkavllsfrlnpmevikggpgqsswwdkvpskfdgw
    tanefekagfravpncivrhsayiapnailmpsfvnlgayvdkgamidtwatvgscaqig
    knvhlsggvgiggvlepmqagptiiedncfigarsevvegcivregsvlgmgvfigkstk
    ivdratgevfygevppysvvvagtmpgknvpgenwgpslycavivkradektrsktsine
    llrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eg4A (A:)
    laslektiekafderdgintatrgevreaveqslilldrgevrvaekqadgnwhvnqwlk
    kavllsfrlnpmevikggpgqsswwdkvpskfdgwtanefekagfravpncivrhsayia
    pnailmpsfvnlgayvdkgamidtwatvgscaqigknvhlsggvgiggvlepmqagptii
    edncfigarsevvegcivregsvlgmgvfigkstkivdratgevfygevppysvvvagtm
    pgknvpgenwgpslycavivkradektrsktsinellrd