PDB entry 3eg3

View 3eg3 on RCSB PDB site
Description: Crystal structure of the N114A mutant of ABL-SH3 domain
Class: transferase
Keywords: beta, ATP-binding, Cell adhesion, Cytoskeleton, Kinase, Lipoprotein, Magnesium, Manganese, Metal-binding, Myristate, Nucleotide-binding, Nucleus, Phosphoprotein, Proto-oncogene, SH2 domain, SH3 domain, Transferase, Tyrosine-protein kinase
Deposited on 2008-09-10, released 2009-09-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.21
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase ABL1
    Species: Homo sapiens [TaxId:9606]
    Gene: ABL1, ABL, JTK7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00519 (1-62)
      • initiating methionine (0)
      • engineered (55)
    Domains in SCOPe 2.08: d3eg3a1, d3eg3a2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3eg3A (A:)
    mendpnlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsayitp
    vns