PDB entry 3efk

View 3efk on RCSB PDB site
Description: Structure of c-Met with pyrimidone inhibitor 50
Class: Transferase
Keywords: c-Met, Kinase inhibitor pyrimidone, Alternative splicing, ATP-binding, Chromosomal rearrangement, Disease mutation, Glycoprotein, Kinase, Membrane, Nucleotide-binding, Phosphoprotein, Polymorphism, Proto-oncogene, Receptor, Transferase, Transmembrane, Tyrosine-protein kinase
Deposited on 2008-09-09, released 2008-10-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.257
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: MET
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08581 (Start-304)
      • engineered (225)
    Domains in SCOPe 2.06: d3efka_
  • Chain 'B':
    Compound: Hepatocyte growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: MET
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08581 (Start-304)
      • engineered (225)
    Domains in SCOPe 2.06: d3efkb_
  • Heterogens: MT4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3efkA (A:)
    mqntvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkih
    cavkslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlr
    nfirnethnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfgla
    rdmydkeyysvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypd
    vntfditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfig
    ehyvhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3efkA (A:)
    dlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcavksln
    ritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfirnet
    hnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfpvkwmalesl
    qtqkfttksdvwsfgvllwelmtrgappypdvntfditvyllqgrrllqpeycpdplyev
    mlkcwhpkaemrpsfselvsrisaifstfigehyvh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3efkB (B:)
    mqntvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkih
    cavkslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlr
    nfirnethnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfgla
    rdmydkeyysvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypd
    vntfditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfig
    ehyvhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3efkB (B:)
    dlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcavksld
    igevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfirnethnpt
    vkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfpvkwmaleslqtqk
    fttksdvwsfgvllwelmtrgappypdvntfditvyllqgrrllqpeycpdplyevmlkc
    whpkaemrpsfselvsrisaifstfigehyvh