PDB entry 3efg

View 3efg on RCSB PDB site
Description: structure of slyx protein from xanthomonas campestris pv. campestris str. atcc 33913
Deposited on 2008-09-08, released 2008-12-09
The last revision was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein slyX homolog
    Species: Xanthomonas campestris pv. campestris [TaxId:340]
    Gene: slyX, XCC1504
    Database cross-references and differences (RAF-indexed):
  • Heterogens: EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3efgA (A:)
mheqlsprdqelearlveletrlsfqeqaltelsealadarltgarnaelirhlledlgk
vrstlfadaadepppphy

    Sequence, based on observed residues (ATOM records):
    >3efgA (A:)
rdqelearlveletrlsfqeqaltelsealadarltgarnaelirhlledl