PDB entry 3efd

View 3efd on RCSB PDB site
Description: The crystal structure of the cytoplasmic domain of KcsA
Class: immune system
Keywords: Helix bundle, C-terminus, IMMUNE SYSTEM
Deposited on 2008-09-08, released 2009-04-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.23
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: FabH
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3EFD (0-221)
  • Chain 'K':
    Compound: KcsA
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 3EFD (0-29)
  • Chain 'L':
    Compound: FabL
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3EFD (0-210)
    Domains in SCOPe 2.08: d3efdl1, d3efdl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3efdL (L:)
    diqmtqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysasslysgvps
    rfsgsgsgtdftltisslqpedfatyycqqysyslltfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqagnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnr