PDB entry 3ef2

View 3ef2 on RCSB PDB site
Description: Structure of the Marasmius oreades mushroom lectin (MOA) in complex with Galalpha(1,3)[Fucalpha(1,2)]Gal and Calcium.
Class: sugar binding protein
Keywords: lectin, beta-trefoil, calcium-binding, carbohydrate-binding, sugar-binding, SUGAR BINDING PROTEIN
Deposited on 2008-09-08, released 2009-06-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-06-30, with a file datestamp of 2009-06-26.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.166
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: agglutinin
    Species: Marasmius oreades [TaxId:181124]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ef2a1, d3ef2a2
  • Chain 'B':
    Compound: agglutinin
    Species: Marasmius oreades [TaxId:181124]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ef2b1, d3ef2b2
  • Chain 'C':
    Compound: agglutinin
    Species: Marasmius oreades [TaxId:181124]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ef2c1, d3ef2c2
  • Chain 'D':
    Compound: agglutinin
    Species: Marasmius oreades [TaxId:181124]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ef2d1, d3ef2d2
  • Heterogens: CA, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ef2A (A:)
    mslrrgiyhienagvpsaidlkdgsssdgtpivgwqftpdtinwhqlwlaepipnvadtf
    tlcnlfsgtymdlyngsseagtavngwqgtafttnphqlwtikkssdgtsykiqnygskt
    fvdlvngdssdgakiagwtgtwdegnphqkwyfnrmsvssaeaqaaiarnphihgtyrgy
    ildgeylvlpnatftqiwkdsglpgskwreqiydcddfaiamkaavgkwgadswkangfa
    ifcgvmlgvnkagdaahaynftltkdhadivffepqnggylndigydsymafy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ef2A (A:)
    slrrgiyhienagvpsaidlkdgsssdgtpivgwqftpdtinwhqlwlaepipnvadtft
    lcnlfsgtymdlyngsseagtavngwqgtafttnphqlwtikkssdgtsykiqnygsktf
    vdlvngdssdgakiagwtgtwdegnphqkwyfnrmsvssaeaqaaiarnphihgtyrgyi
    ldgeylvlpnatftqiwkdsglpgskwreqiydcddfaiamkaavgkwgadswkangfai
    fcgvmlgvnkagdaahaynftltkdhadivffepqnggylndigydsymafy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ef2B (B:)
    mslrrgiyhienagvpsaidlkdgsssdgtpivgwqftpdtinwhqlwlaepipnvadtf
    tlcnlfsgtymdlyngsseagtavngwqgtafttnphqlwtikkssdgtsykiqnygskt
    fvdlvngdssdgakiagwtgtwdegnphqkwyfnrmsvssaeaqaaiarnphihgtyrgy
    ildgeylvlpnatftqiwkdsglpgskwreqiydcddfaiamkaavgkwgadswkangfa
    ifcgvmlgvnkagdaahaynftltkdhadivffepqnggylndigydsymafy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ef2B (B:)
    slrrgiyhienagvpsaidlkdgsssdgtpivgwqftpdtinwhqlwlaepipnvadtft
    lcnlfsgtymdlyngsseagtavngwqgtafttnphqlwtikkssdgtsykiqnygsktf
    vdlvngdssdgakiagwtgtwdegnphqkwyfnrmsvssaeaqaaiarnphihgtyrgyi
    ldgeylvlpnatftqiwkdsglpgskwreqiydcddfaiamkaavgkwgadswkangfai
    fcgvmlgvnkagdaahaynftltkdhadivffepqnggylndigydsymafy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ef2C (C:)
    mslrrgiyhienagvpsaidlkdgsssdgtpivgwqftpdtinwhqlwlaepipnvadtf
    tlcnlfsgtymdlyngsseagtavngwqgtafttnphqlwtikkssdgtsykiqnygskt
    fvdlvngdssdgakiagwtgtwdegnphqkwyfnrmsvssaeaqaaiarnphihgtyrgy
    ildgeylvlpnatftqiwkdsglpgskwreqiydcddfaiamkaavgkwgadswkangfa
    ifcgvmlgvnkagdaahaynftltkdhadivffepqnggylndigydsymafy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ef2C (C:)
    slrrgiyhienagvpsaidlkdgsssdgtpivgwqftpdtinwhqlwlaepipnvadtft
    lcnlfsgtymdlyngsseagtavngwqgtafttnphqlwtikkssdgtsykiqnygsktf
    vdlvngdssdgakiagwtgtwdegnphqkwyfnrmsvssaeaqaaiarnphihgtyrgyi
    ldgeylvlpnatftqiwkdsglpgskwreqiydcddfaiamkaavgkwgadswkangfai
    fcgvmlgvnkagdaahaynftltkdhadivffepqnggylndigydsymafy
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ef2D (D:)
    mslrrgiyhienagvpsaidlkdgsssdgtpivgwqftpdtinwhqlwlaepipnvadtf
    tlcnlfsgtymdlyngsseagtavngwqgtafttnphqlwtikkssdgtsykiqnygskt
    fvdlvngdssdgakiagwtgtwdegnphqkwyfnrmsvssaeaqaaiarnphihgtyrgy
    ildgeylvlpnatftqiwkdsglpgskwreqiydcddfaiamkaavgkwgadswkangfa
    ifcgvmlgvnkagdaahaynftltkdhadivffepqnggylndigydsymafy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ef2D (D:)
    slrrgiyhienagvpsaidlkdgsssdgtpivgwqftpdtinwhqlwlaepipnvadtft
    lcnlfsgtymdlyngsseagtavngwqgtafttnphqlwtikkssdgtsykiqnygsktf
    vdlvngdssdgakiagwtgtwdegnphqkwyfnrmsvssaeaqaaiarnphihgtyrgyi
    ldgeylvlpnatftqiwkdsglpgskwreqiydcddfaiamkaavgkwgadswkangfai
    fcgvmlgvnkagdaahaynftltkdhadivffepqnggylndigydsymafy