PDB entry 3eei

View 3eei on RCSB PDB site
Description: Crystal structure of 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase from neisseria meningitidis in complex with methylthio-immucillin-A
Class: hydrolase
Keywords: MTAN, 5'-METHYLTHIOADENOSINE/S-ADENOSYLHOMOCYSTEINE NUCLEOSIDASE, Immucillin A, Glycosidase, Hydrolase
Deposited on 2008-09-04, released 2009-09-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-09-08, with a file datestamp of 2009-09-04.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.185
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5-methylthioadenosine nucleosidase/S-adenosylhomocysteine nucleosidase
    Species: Neisseria meningitidis serogroup B [TaxId:491]
    Gene: pfs
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3eeia_
  • Chain 'B':
    Compound: 5-methylthioadenosine nucleosidase/S-adenosylhomocysteine nucleosidase
    Species: Neisseria meningitidis serogroup B [TaxId:491]
    Gene: pfs
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3eeib_
  • Heterogens: MTM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3eeiA (A:)
    mslktvavigameqeiellremmenvkavsfgrfsayegelagkrmvlalsgigkvnaav
    atawiirefaadcvintgsagglgkglkvgdvvigtetahhdvdvtafgyawgqvpqlpa
    rfasdgilieaakraartfegaaveqglivsgdrfvhssegvaeirkhfpevkavemeaa
    aiaqtchqletpfviiravsdsadekadisfdeflktaaansakmvaeivksl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eeiA (A:)
    lktvavigameqeiellremmenvkavsfgrfsayegelagkrmvlalsgigkvnaavat
    awiirefaadcvintgsagglgkglkvgdvvigtetahhdvdvtafgyawgqvpqlparf
    asdgilieaakraartfegaaveqglivsgdrfvhssegvaeirkhfpevkavemeaaai
    aqtchqletpfviiravsdsadekadisfdeflktaaansakmvaeivksl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3eeiB (B:)
    mslktvavigameqeiellremmenvkavsfgrfsayegelagkrmvlalsgigkvnaav
    atawiirefaadcvintgsagglgkglkvgdvvigtetahhdvdvtafgyawgqvpqlpa
    rfasdgilieaakraartfegaaveqglivsgdrfvhssegvaeirkhfpevkavemeaa
    aiaqtchqletpfviiravsdsadekadisfdeflktaaansakmvaeivksl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eeiB (B:)
    lktvavigameqeiellremmenvkavsfgrfsayegelagkrmvlalsgigkvnaavat
    awiirefaadcvintgsagglgkglkvgdvvigtetahhdvdvtafgyawgqvpqlparf
    asdgilieaakraartfegaaveqglivsgdrfvhssegvaeirkhfpevkavemeaaai
    aqtchqletpfviiravsdsadekadisfdeflktaaansakmvaeivksl