PDB entry 3eed

View 3eed on RCSB PDB site
Description: Crystal structure of human protein kinase CK2 regulatory subunit (CK2beta; mutant 1-193)
Class: transferase
Keywords: protein kinase CK2, casein kinase 2, casein kinase II, eukaryotic protein kinases, Phosphoprotein, Wnt signaling pathway, TRANSFERASE
Deposited on 2008-09-04, released 2008-09-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2008-12-02, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.176
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Casein kinase II subunit beta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3eeda_
  • Chain 'B':
    Compound: Casein kinase II subunit beta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3eedb_
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3eedA (A:)
    mssseevswiswfcglrgneffcevdedyiqdkfnltglneqvphyrqaldmildlepde
    elednpnqsdlieqaaemlygliharyiltnrgiaqmlekyqqgdfgycprvycenqpml
    piglsdipgeamvklycpkcmdvytpkssrhhhtdgayfgtgfphmlfmvhpeyrpkrpa
    nqfvprlygfkih
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eedA (A:)
    evswiswfcglrgneffcevdedyiqdkfnltglneqvphyrqaldmildlepdnpnqsd
    lieqaaemlygliharyiltnrgiaqmlekyqqgdfgycprvycenqpmlpiglsdipge
    amvklycpkcmdvytpkssrhhhtdgayfgtgfphmlfmvhpeyrpkrpanqfvprlygf
    kih
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3eedB (B:)
    mssseevswiswfcglrgneffcevdedyiqdkfnltglneqvphyrqaldmildlepde
    elednpnqsdlieqaaemlygliharyiltnrgiaqmlekyqqgdfgycprvycenqpml
    piglsdipgeamvklycpkcmdvytpkssrhhhtdgayfgtgfphmlfmvhpeyrpkrpa
    nqfvprlygfkih
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eedB (B:)
    evswiswfcglrgneffcevdedyiqdkfnltglneqvphyrqaldmildlepdnpnqsd
    lieqaaemlygliharyiltnrgiaqmlekyqqgdfgycprvycenqpmlpiglsdipge
    amvklycpkcmdvytpkssrhhhtdgayfgtgfphmlfmvhpeyrpkrpanqfvprlygf
    kih