SCOPe 2.01: Structural Classification of Proteins

PDB entry 3ee3

View 3ee3 on RCSB PDB site
Description: Crystal structure of Acanthamoeba polyphaga mimivirus nucleoside diphosphate kinase complexed with CDP
Class: transferase
Keywords: phosphotransferase ATP-binding mimivirus, ATP-binding, Kinase, Magnesium, Metal-binding, Nucleotide metabolism, Nucleotide-binding, Phosphoprotein, Transferase
Deposited on 2008-09-04, released 2009-06-16
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.196
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Nucleoside diphosphate kinase
Species: Acanthamoeba polyphaga mimivirus [TaxId:212035]
Gene: NDK, MIMI_R418
Database cross-references and differences (RAF-indexed):
- Uniprot Q5UQL3 (6-End)
  - expression tag (4-5)
Domains in SCOPe 2.01: d3ee3a_
Chain 'B':
Compound: Nucleoside diphosphate kinase
Species: Acanthamoeba polyphaga mimivirus [TaxId:212035]
Gene: NDK, MIMI_R418
Database cross-references and differences (RAF-indexed):
- Uniprot Q5UQL3 (6-End)
  - expression tag (4-5)
Domains in SCOPe 2.01: d3ee3b_
Chain 'C':
Compound: Nucleoside diphosphate kinase
Species: Acanthamoeba polyphaga mimivirus [TaxId:212035]
Gene: NDK, MIMI_R418
Database cross-references and differences (RAF-indexed):
- Uniprot Q5UQL3 (6-End)
  - expression tag (4-5)
Domains in SCOPe 2.01: d3ee3c_
Chain 'D':
Compound: Nucleoside diphosphate kinase
Species: Acanthamoeba polyphaga mimivirus [TaxId:212035]
Gene: NDK, MIMI_R418
Database cross-references and differences (RAF-indexed):
- Uniprot Q5UQL3 (6-End)
  - expression tag (4-5)
Domains in SCOPe 2.01: d3ee3d_
Chain 'E':
Compound: Nucleoside diphosphate kinase
Species: Acanthamoeba polyphaga mimivirus [TaxId:212035]
Gene: NDK, MIMI_R418
Database cross-references and differences (RAF-indexed):
- Uniprot Q5UQL3 (6-End)
  - expression tag (4-5)
Domains in SCOPe 2.01: d3ee3e_
Chain 'F':
Compound: Nucleoside diphosphate kinase
Species: Acanthamoeba polyphaga mimivirus [TaxId:212035]
Gene: NDK, MIMI_R418
Database cross-references and differences (RAF-indexed):
- Uniprot Q5UQL3 (6-End)
  - expression tag (4-5)
Domains in SCOPe 2.01: d3ee3f_
Heterogens: CDP, MG, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>3ee3A (A:)
ykkaglqrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehse
qsyfndncdfmvsgpiisivyegtdaiskirrlqgniltpgtirgdlandirenlihasd
sedsavdeisiwfpetkmetdn