PDB entry 3edh

View 3edh on RCSB PDB site
Description: Crystal structure of bone morphogenetic protein 1 protease domain in complex with partially bound DMSO
Class: hydrolase
Keywords: vicinal disulfide, Alternative splicing, Calcium, Chondrogenesis, Cleavage on pair of basic residues, Cytokine, Developmental protein, Differentiation, EGF-like domain, Glycoprotein, Growth factor, Hydrolase, Metal-binding, Metalloprotease, Osteogenesis, Polymorphism, Protease, Zinc, Zymogen
Deposited on 2008-09-03, released 2008-09-16
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.142
AEROSPACI score: 0.8 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bone morphogenetic protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: BMP1, PCOLC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3edha_
  • Heterogens: ACE, ZN, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3edhA (A:)
aatsrpervwpdgvipfviggnftgsqravfrqamrhwekhtcvtflertdedsyivfty
rpcgccsyvgrrgggpqaisigkncdkfgivvhelghvvgfwhehtrpdrdrhvsivren
iqpgqeynflkmepqeveslgetydfdsimhyarntfsrgifldtivpkyevngvkppig
qrtrlskgdiaqarklykcpa