PDB entry 3edd

View 3edd on RCSB PDB site
Description: Structural base for cyclodextrin hydrolysis
Class: hydrolase
Keywords: alpha-cyclodextrin binding, HYDROLASE, Glycosidase
Deposited on 2008-09-03, released 2009-03-03
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-03-03, with a file datestamp of 2009-02-27.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.223
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclomaltodextrinase
    Species: Flavobacterium sp. 92 [TaxId:197856]
    Gene: cdase
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8KKG0
      • engineered (339)
    Domains in SCOPe 2.04: d3edda1, d3edda2, d3edda3
  • Chain 'B':
    Compound: cyclomaltodextrinase
    Species: Flavobacterium sp. 92 [TaxId:197856]
    Gene: cdase
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8KKG0
      • engineered (339)
    Domains in SCOPe 2.04: d3eddb1, d3eddb2, d3eddb3
  • Heterogens: CA, ACX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3eddA (A:)
    aaptaiehmeppfwwagmqhkglqlmvhgrdigrmeaaldypgvrlvsttrvpnanylfv
    dleigpeaqpgsfdivfkgdgrseryryrllareqgsaqrqgfgpgdaiyqimpdrfang
    dpsndnvagmreqadrrhgggrhggdirgtidhldyiaglgftqlwptplvendaaaysy
    hgyaatdhyridprygsnedfvrlstearkrgmgliqdvvlshigkhhwwmkdlptpdwi
    nyggkfvptqhhrvavqdpyaaqadsenftkgwfvegmpdlnqtnplvanyliqnniwwi
    eyaglsglridtygysdgaflteytrrlmaeyprlnmvgqewstrvpvvarwqrgkanfd
    gytshlpslmdfplvdamrnalsktgeenglnevyetlsldylypepqnlvlfggnhdma
    rmfsaagedfdrwrmnlvflmtmpripqfysgdeilmtstvkgrddasyrrdfpggwagd
    kanafsgagltsqqraaqdlvrklanwrknqpvihngrlmhfgpeentwvyfrynkdkri
    mvamnnndkpmtlptarfqemlkgapsgvdflsgktvglgrelrlapksvvvielpglpe
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eddA (A:)
    ptaiehmeppfwwagmqhkglqlmvhgrdigrmeaaldypgvrlvsttrvpnanylfvdl
    eigpeaqpgsfdivfkgdgrseryryrllareqgsaqrqgfgpgdaiyqimpdrfangdp
    sndnvagmreqadrrhgggrhggdirgtidhldyiaglgftqlwptplvendaaaysyhg
    yaatdhyridprygsnedfvrlstearkrgmgliqdvvlshigkhhwwmkdlptpdwiny
    ggkfvptqhhrvavqdpyaaqadsenftkgwfvegmpdlnqtnplvanyliqnniwwiey
    aglsglridtygysdgaflteytrrlmaeyprlnmvgqewstrvpvvarwqrgkanfdgy
    tshlpslmdfplvdamrnalsktgeenglnevyetlsldylypepqnlvlfggnhdmarm
    fsaagedfdrwrmnlvflmtmpripqfysgdeilmtstvkgrddasyrrdfpggwagdka
    nafsgagltsqqraaqdlvrklanwrknqpvihngrlmhfgpeentwvyfrynkdkrimv
    amnnndkpmtlptarfqemlkgapsgvdflsgktvglgrelrlapksvvvielpglp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3eddB (B:)
    aaptaiehmeppfwwagmqhkglqlmvhgrdigrmeaaldypgvrlvsttrvpnanylfv
    dleigpeaqpgsfdivfkgdgrseryryrllareqgsaqrqgfgpgdaiyqimpdrfang
    dpsndnvagmreqadrrhgggrhggdirgtidhldyiaglgftqlwptplvendaaaysy
    hgyaatdhyridprygsnedfvrlstearkrgmgliqdvvlshigkhhwwmkdlptpdwi
    nyggkfvptqhhrvavqdpyaaqadsenftkgwfvegmpdlnqtnplvanyliqnniwwi
    eyaglsglridtygysdgaflteytrrlmaeyprlnmvgqewstrvpvvarwqrgkanfd
    gytshlpslmdfplvdamrnalsktgeenglnevyetlsldylypepqnlvlfggnhdma
    rmfsaagedfdrwrmnlvflmtmpripqfysgdeilmtstvkgrddasyrrdfpggwagd
    kanafsgagltsqqraaqdlvrklanwrknqpvihngrlmhfgpeentwvyfrynkdkri
    mvamnnndkpmtlptarfqemlkgapsgvdflsgktvglgrelrlapksvvvielpglpe
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eddB (B:)
    ptaiehmeppfwwagmqhkglqlmvhgrdigrmeaaldypgvrlvsttrvpnanylfvdl
    eigpeaqpgsfdivfkgdgrseryryrllareqgsaqrqgfgpgdaiyqimpdrfangdp
    sndnvagmreqadrrhgggrhggdirgtidhldyiaglgftqlwptplvendaaaysyhg
    yaatdhyridprygsnedfvrlstearkrgmgliqdvvlshigkhhwwmkdlptpdwiny
    ggkfvptqhhrvavqdpyaaqadsenftkgwfvegmpdlnqtnplvanyliqnniwwiey
    aglsglridtygysdgaflteytrrlmaeyprlnmvgqewstrvpvvarwqrgkanfdgy
    tshlpslmdfplvdamrnalsktgeenglnevyetlsldylypepqnlvlfggnhdmarm
    fsaagedfdrwrmnlvflmtmpripqfysgdeilmtstvkgrddasyrrdfpggwagdka
    nafsgagltsqqraaqdlvrklanwrknqpvihngrlmhfgpeentwvyfrynkdkrimv
    amnnndkpmtlptarfqemlkgapsgvdflsgktvglgrelrlapksvvvielpglp