PDB entry 3edc

View 3edc on RCSB PDB site
Description: Crystal Structure of a 1.6-hexanediol Bound Tetrameric Form of Escherichia coli Lac-repressor Refined to 2.1 Resolution
Class: transcription
Keywords: Lac-repressor, allosteric, tetramer, DNA-binding, Repressor, Transcription, Transcription regulation
Deposited on 2008-09-03, released 2008-11-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.159
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lactose operon repressor
    Species: Escherichia coli K12 [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3edca_
  • Chain 'B':
    Compound: lactose operon repressor
    Species: Escherichia coli K12 [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3edcb_
  • Chain 'C':
    Compound: lactose operon repressor
    Species: Escherichia coli K12 [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3edcc_
  • Chain 'D':
    Compound: lactose operon repressor
    Species: Escherichia coli K12 [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3edcd_
  • Heterogens: HEZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3edcA (A:)
    mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkq
    slligvatsslalhapsqivaaiksradqlgasvvvsmversgveackaavhnllaqrvs
    gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq
    qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
    amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
    vdrllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrlesgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3edcA (A:)
    slligvatsslalhapsqivaaiksradqlgasvvvsmversgveackaavhnllaqrvs
    gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq
    qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
    amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
    vdrllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrlesgq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3edcB (B:)
    mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkq
    slligvatsslalhapsqivaaiksradqlgasvvvsmversgveackaavhnllaqrvs
    gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq
    qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
    amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
    vdrllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrlesgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3edcB (B:)
    slligvatsslalhapsqivaaiksradqlgasvvvsmversgveackaavhnllaqrvs
    gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq
    qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
    amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
    vdrllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrlesgq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3edcC (C:)
    mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkq
    slligvatsslalhapsqivaaiksradqlgasvvvsmversgveackaavhnllaqrvs
    gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq
    qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
    amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
    vdrllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrlesgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3edcC (C:)
    slligvatsslalhapsqivaaiksradqlgasvvvsmversgveackaavhnllaqrvs
    gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq
    qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
    amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
    vdrllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrlesgq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3edcD (D:)
    mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkq
    slligvatsslalhapsqivaaiksradqlgasvvvsmversgveackaavhnllaqrvs
    gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq
    qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
    amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
    vdrllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrlesgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3edcD (D:)
    slligvatsslalhapsqivaaiksradqlgasvvvsmversgveackaavhnllaqrvs
    gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq
    qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
    amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
    vdrllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrlesgq