PDB entry 3ed8

View 3ed8 on RCSB PDB site
Description: Application of the superfolder YFP bimolecular fluorescence complementation for studying protein-protein interactions in vitro
Class: luminescent protein
Keywords: superfolder, bimolecular fluorescence complementation, LUMINESCENT PROTEIN
Deposited on 2008-09-02, released 2009-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.177
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: yellow fluorescence protein
    Species: Aequorea victoria [TaxId:6100]
    Database cross-references and differences (RAF-indexed):
    • PDB 3ED8
      • chromophore, see remark 999 (65)
    Domains in SCOPe 2.07: d3ed8a_
  • Chain 'B':
    Compound: yellow fluorescence protein
    Species: Aequorea victoria [TaxId:6100]
    Database cross-references and differences (RAF-indexed):
    • PDB 3ED8
      • chromophore, see remark 999 (65)
    Domains in SCOPe 2.07: d3ed8b_
  • Chain 'C':
    Compound: yellow fluorescence protein
    Species: Aequorea victoria [TaxId:6100]
    Database cross-references and differences (RAF-indexed):
    • PDB 3ED8
      • chromophore, see remark 999 (65)
    Domains in SCOPe 2.07: d3ed8c_
  • Chain 'D':
    Compound: yellow fluorescence protein
    Species: Aequorea victoria [TaxId:6100]
    Database cross-references and differences (RAF-indexed):
    • PDB 3ED8
      • chromophore, see remark 999 (65)
    Domains in SCOPe 2.07: d3ed8d_
  • Chain 'E':
    Compound: yellow fluorescence protein
    Species: Aequorea victoria [TaxId:6100]
    Database cross-references and differences (RAF-indexed):
    • PDB 3ED8
      • chromophore, see remark 999 (65)
    Domains in SCOPe 2.07: d3ed8e_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ed8A (A:)
    vskgeelftgvvpilveldgdvnghkfsvrgegegdatigkltlkficttgklpvpwptl
    vttlgyglqcfarypdhmkqhdffksampegyvqertisfkddgkyktravvkfegdtlv
    nrielkgtdfkedgnilghkleynfnshnvyitatrgtaaarpackipndlkqkvmnhdk
    qkngikanftvrhnvedgsvqladhyqqntpigdgpvllpdnhylsyqtvlskdpnekrd
    hmvllefvtaagitlgmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ed8A (A:)
    skgeelftgvvpilveldgdvnghkfsvrgegegdatigkltlkficttgklpvpwptlv
    ttlgyglqcfarypdhmkqhdffksampegyvqertisfkddgkyktravvkfegdtlvn
    rielkgtdfkedgnilghkleynfnshnvyitatrgtqkngikanftvrhnvedgsvqla
    dhyqqntpigdgpvllpdnhylsyqtvlskdpnekrdhmvllefvtaagit
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ed8B (B:)
    vskgeelftgvvpilveldgdvnghkfsvrgegegdatigkltlkficttgklpvpwptl
    vttlgyglqcfarypdhmkqhdffksampegyvqertisfkddgkyktravvkfegdtlv
    nrielkgtdfkedgnilghkleynfnshnvyitatrgtaaarpackipndlkqkvmnhdk
    qkngikanftvrhnvedgsvqladhyqqntpigdgpvllpdnhylsyqtvlskdpnekrd
    hmvllefvtaagitlgmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ed8B (B:)
    skgeelftgvvpilveldgdvnghkfsvrgegegdatigkltlkficttgklpvpwptlv
    ttlgyglqcfarypdhmkqhdffksampegyvqertisfkddgkyktravvkfegdtlvn
    rielkgtdfkedgnilghkleynfnshnvyitatrgkngikanftvrhnvedgsvqladh
    yqqntpigdgpvllpdnhylsyqtvlskdpnekrdhmvllefvtaagitl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ed8C (C:)
    vskgeelftgvvpilveldgdvnghkfsvrgegegdatigkltlkficttgklpvpwptl
    vttlgyglqcfarypdhmkqhdffksampegyvqertisfkddgkyktravvkfegdtlv
    nrielkgtdfkedgnilghkleynfnshnvyitatrgtaaarpackipndlkqkvmnhdk
    qkngikanftvrhnvedgsvqladhyqqntpigdgpvllpdnhylsyqtvlskdpnekrd
    hmvllefvtaagitlgmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ed8C (C:)
    skgeelftgvvpilveldgdvnghkfsvrgegegdatigkltlkficttgklpvpwptlv
    ttlgyglqcfarypdhmkqhdffksampegyvqertisfkddgkyktravvkfegdtlvn
    rielkgtdfkedgnilghkleynfnshnvyitatrgtkqkngikanftvrhnvedgsvql
    adhyqqntpigdgpvllpdnhylsyqtvlskdpnekrdhmvllefvtaagitl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ed8D (D:)
    vskgeelftgvvpilveldgdvnghkfsvrgegegdatigkltlkficttgklpvpwptl
    vttlgyglqcfarypdhmkqhdffksampegyvqertisfkddgkyktravvkfegdtlv
    nrielkgtdfkedgnilghkleynfnshnvyitatrgtaaarpackipndlkqkvmnhdk
    qkngikanftvrhnvedgsvqladhyqqntpigdgpvllpdnhylsyqtvlskdpnekrd
    hmvllefvtaagitlgmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ed8D (D:)
    skgeelftgvvpilveldgdvnghkfsvrgegegdatigkltlkficttgklpvpwptlv
    ttlgyglqcfarypdhmkqhdffksampegyvqertisfkddgkyktravvkfegdtlvn
    rielkgtdfkedgnilghkleynfnshnvyitatrgtkngikanftvrhnvedgsvqlad
    hyqqntpigdgpvllpdnhylsyqtvlskdpnekrdhmvllefvtaagitl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3ed8E (E:)
    vskgeelftgvvpilveldgdvnghkfsvrgegegdatigkltlkficttgklpvpwptl
    vttlgyglqcfarypdhmkqhdffksampegyvqertisfkddgkyktravvkfegdtlv
    nrielkgtdfkedgnilghkleynfnshnvyitatrgtaaarpackipndlkqkvmnhdk
    qkngikanftvrhnvedgsvqladhyqqntpigdgpvllpdnhylsyqtvlskdpnekrd
    hmvllefvtaagitlgmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ed8E (E:)
    kgeelftgvvpilveldgdvnghkfsvrgegegdatigkltlkficttgklpvpwptlvt
    tlgyglqcfarypdhmkqhdffksampegyvqertisfkddgkyktravvkfegdtlvnr
    ielkgtdfkedgnilghkleynfnshnvyitatrgikanftvrhnvedgsvqladhyqqn
    tpigdgpvllpdnhylsyqtvlskdpnekhmvllefvtaagitl