PDB entry 3ed5

View 3ed5 on RCSB PDB site
Description: The crystal structure of YfnB from Bacillus subtilis subsp. subtilis str. 168
Class: structural genomics, unknown function
Keywords: APC60080, YfnB, Bacillus subtilis subsp. subtilis str. 168, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, unknown function
Deposited on 2008-09-02, released 2008-09-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: 0.172
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: YfnB
    Species: Bacillus subtilis [TaxId:1423]
    Gene: yfnB, BSU07330
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ed5a_
  • Heterogens: FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ed5A (A:)
    snamkryrtllfdvddtildfqaaealalrllfedqnipltndmkaqyktinqglwrafe
    egkmtrdevvntrfsallkeygyeadgalleqkyrrfleeghqlidgafdlisnlqqqfd
    lyivtngvshtqykrlrdsglfpffkdifvsedtgfqkpmkeyfnyvferipqfsaehtl
    iigdsltadikggqlagldtcwmnpdmkpnvpeiiptyeirkleelyhilnientvsc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ed5A (A:)
    mkryrtllfdvddtildfqaaealalrllfedqnipltndmkaqyktinqglwrafeegk
    mtrdevvntrfsallkeygyeadgalleqkyrrfleeghqlidgafdlisnlqqqfdlyi
    vtngvshtqykrlrdsglfpffkdifvsedtgfqkpmkeyfnyvferipqfsaehtliig
    dsltadikggqlagldtcwmnpdmkpnvpeiiptyeirkleelyhilnient