PDB entry 3ecz

View 3ecz on RCSB PDB site
Description: Carbonmonoxy Sperm Whale Myoglobin at 120 K: Laser on [30 min]
Class: oxygen transport
Keywords: haem protein, myoglobin, ligand migration, photodissociation, Heme, Iron, Metal-binding, Muscle protein, Oxygen transport, Transport
Deposited on 2008-09-02, released 2009-02-24
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-03-10, with a file datestamp of 2009-03-06.
Experiment type: XRAY
Resolution: 1.21 Å
R-factor: 0.145
AEROSPACI score: 0.85 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myoglobin
  Species: Physeter catodon [TaxId:9755]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02185 (0-152)
  Domains in SCOPe 2.05: d3ecza_
• Heterogens: HEM, CMO, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3eczA (A:)
  vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
  lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
  gdfgadaqgamnkalelfrkdiaakykelgyqg