PDB entry 3ect

View 3ect on RCSB PDB site
Description: Crystal Structure of the Hexapeptide-Repeat Containing-Acetyltransferase VCA0836 from Vibrio cholerae
Class: transferase
Keywords: alpha-beta structure, beta-helix, TRANSFERASE, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID
Deposited on 2008-09-02, released 2008-09-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.51 Å
R-factor: 0.196
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hexapeptide-repeat containing-acetyltransferase
    Species: Vibrio cholerae [TaxId:666]
    Gene: VC_A0836
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ecta_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ectA (A:)
    snamkmselekmlkgehfdgasaeiealrsqagrlkleinqsldeaeryalqrelfghlg
    hkscvqppfhcefgktirigdhtfinmnvvmldgapitigdhvligpstqfytashsldy
    rrrqawetickpivieddvwiggnvvinqgvtigarsvvaansvvnqdvppdtlvggtpa
    rilrslkdpaesmae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ectA (A:)
    lekmlkghasaeiealrsqagrlkleinqsldeaeryalqrelfghlghkscvqppfhce
    fgktirigdhtfinmnvvmldgapitigdhvligpstqfytashsldyrrrqawetickp
    ivieddvwiggnvvinqgvtigarsvvaansvvnqdvppdtlvggtparilrslkd