PDB entry 3ecm

View 3ecm on RCSB PDB site
Description: Crystal structure of the unliganded PDE8A catalytic domain
Class: hydrolase
Keywords: Phosphodiesterase 8A PDE8A inhibitor selectivity, Alternative splicing, cAMP, Hydrolase, Magnesium, Manganese, Metal-binding
Deposited on 2008-09-01, released 2008-11-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-03-17, with a file datestamp of 2009-03-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.236
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE8A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3ecma_
  • Heterogens: ZN, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ecmA (A:)
    ddvppriarameneeywdfdifeleaathnrpliylglkmfarfgiceflhcsestlrsw
    lqiieanyhssnpyhnsthsadvlhatayflskeriketldpidevaaliaatihdvdhp
    grtnsflcnagselailyndtavleshhaalafqlttgddkcnifknmerndyrtlrqgi
    idmvlatemtkhfehvnkfvnsinkplatleengetdknqevintmlrtpenrtlikrml
    ikcadvsnpcrplqyciewaariseeyfsqtdeekqqglpvvmpvfdrntcsipksqisf
    idyfitdmfdawdafvdlpdlmqhldnnfkywkgldem