PDB entry 3ec8

View 3ec8 on RCSB PDB site
Description: The crystal structure of the RA domain of FLJ10324 (RADIL)
Deposited on 2008-08-29, released 2008-09-30
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.231
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative uncharacterized protein FLJ10324
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A4D1Z5 (23-End)
      • expression tag (13-22)
  • Heterogens: CL, PB, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3ec8A (A:)
mhhhhhhssgvdlgtenlyfqsmdpaelstqlsapgvlkvfgdsvctgthyksvlatgts
sarelvkealeryaldprqagqyvlcdvvgqagdagqrwqarcfrvfgdsekplliqelw
kpreglsrrfelrkrsdveelaakevdtitaginaqarrlqrsrak

    Sequence, based on observed residues (ATOM records):
    >3ec8A (A:)
gtenlyfqsmdpaelstqlsapgvlkvfgdstgthyksvlatgtssarelvkealeryal
dprqagqyvlcdvvgwqarcfrvfgdsekplliqelwkpreglsrrfelrkrsdveelaa
kevdtitaginaqarrlqr