PDB entry 3ec2

View 3ec2 on RCSB PDB site
Description: crystal structure of the dnac helicase loader
Deposited on 2008-08-28, released 2008-11-25
The last revision was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA replication protein DnaC
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: dnaC, aq_910
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67056 (1-179)
      • expression tag (0)
  • Heterogens: ADP, MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3ec2A (A:)
akrywnanldtyhpknvsqnralltirvfvhnfnpeegkgltfvgspgvgkthlavatlk
aiyekkgirgyffdtkdlifrlkhlmdegkdtkflktvlnspvlvlddlgserlsdwqre
lisyiityrynnlkstiittnyslqreeessvrisadlasrlgenvvskiyemnellvik

    Sequence, based on observed residues (ATOM records):
    >3ec2A (A:)
akrywnanldtyhpknvsqnralltirvfvhnfnpeegkgltfvgspgvgkthlavatlk
aiyekkgirgyffdtkdlifrlkhlmdegkdtkflktvlnspvlvlddlgserlsdwqre
lisyiityrynnlkstiittnyslqrssvrisadlasrlgenvvskiyemnellvik