PDB entry 3ec0
View 3ec0 on RCSB PDB site
Description: High Resolution HIV-2 Protease Structure in Complex with Antiviral Inhibitor GRL-06579A
Class: hydrolase
Keywords: HIV-2, aspartic protease, inhibitor, protease-inhibitor complex, HYDROLASE
Deposited on
2008-08-28, released
2008-09-16
The last revision prior to the SCOPe 2.08 freeze date was dated
2008-12-30, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 1.18 Å
R-factor: 0.159
AEROSPACI score: 0.83
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Protease
Species: Human immunodeficiency virus type 2 (ISOLATE ROD) [TaxId:11720]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3ec0a_ - Chain 'B':
Compound: Protease
Species: Human immunodeficiency virus type 2 (ISOLATE ROD) [TaxId:11720]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3ec0b_ - Heterogens: GRL, IMD, ZN, CL, NA, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3ec0A (A:)
pqfslwkrpvvtayiegqpvevlldtgaddsivagielgnnyspkivggiggfintkeyk
nveievlnkkvratimtgdtpinifgrniltalgmslnl
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3ec0B (B:)
pqfslwkrpvvtayiegqpvevlldtgaddsivagielgnnyspkivggiggfintkeyk
nveievlnkkvratimtgdtpinifgrniltalgmslnl