PDB entry 3eby

View 3eby on RCSB PDB site
Description: Crystal structure of the beta subunit of a putative aromatic-ring-hydroxylating dioxygenase (YP_001165631.1) from NOVOSPHINGOBIUM AROMATICIVORANS DSM 12444 at 1.75 A resolution
Class: structural genomics, unknown function
Keywords: YP_001165631.1, the beta subunit of a putative aromatic-ring-hydroxylating dioxygenase, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, Dioxygenase, Unknown function
Deposited on 2008-08-28, released 2008-09-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta subunit of a putative Aromatic-ring-hydroxylating dioxygenase
    Species: Novosphingobium aromaticivorans DSM 12444 [TaxId:279238]
    Gene: YP_001165631.1, Saro_3860
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3ebya1
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ebyA (A:)
    gmsvaaevaqvaqsaiddfnaayglcldddrleqwptlfvddclyqviarenvdnglpaa
    vmycdskgmladrvvalrkanvfpehfnrhligravitgvegdqvsaeasyvvfqtrndg
    etriynagkyvdrfdlsggtvrlksrtciydtlriatllatpi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ebyA (A:)
    evaqvaqsaiddfnaayglcldddrleqwptlfvddclyqviarenvdnglpaavmycds
    kgmladrvvalrkanhfnrhligravitgvegdqvsaeasyvvfqtrndgetriynagky
    vdrfdlsggtvrlksrtciydtlriatllatpi