PDB entry 3ebp

View 3ebp on RCSB PDB site
Description: Glycogen Phosphorylase b/flavopiridol complex
Class: transferase/transferase inhibitor
Keywords: glycogen phosphorylase, rational inhibitor design, glycogenolysis, diabetes type 2, Allosteric enzyme, Carbohydrate metabolism, Glycogen metabolism, Glycosyltransferase, Nucleotide-binding, Phosphoprotein, Pyridoxal phosphate, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2008-08-28, released 2009-09-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-12-11, with a file datestamp of 2013-12-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.19
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen phosphorylase, muscle form
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ebpa_
  • Heterogens: CPB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ebpA (A:)
    srplsdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvr
    dhlvgrwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldme
    eleeieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeead
    dwlrygnpwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvnt
    mrlwsakapndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvv
    aatlqdiirrfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerld
    wdkawevtvktcaytnhtvlpealerwpvhlletllprhlqiiyeinqrflnrvaaafpg
    dvdrlrrmslveegavkrinmahlciagshavngvarihseilkktifkdfyelephkfq
    nktngitprrwlvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqe
    nklkfaaylereykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvp
    rtvmiggkaapgyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaa
    dlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdr
    ldqrgynaqeyydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeey
    vkcqervsalyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapdek
    ip
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ebpA (A:)
    qisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrwirtq
    qhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeieedagl
    gngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygnpwek
    arpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsakapnd
    fnlgyiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfksstnf
    dafpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvktcaytnhtvlpealer
    wpvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveegavkrinmahlci
    agshavngvarihseilkktifkdfyelephkfqnktngitprrwlvlcnpglaeiiaer
    igeeyisdldqlrkllsyvddeafirdvakvkqenklkfaaylereykvhinpnslfdvq
    vkriheykrqllnclhvitlynrikkepnkfvvprtvmiggkaapgyhmakmiiklitai
    gdvvnhdpvvgdrlrviflenyrvslaekvipaadlseqistagteasgtgnmkfmlnga
    ltigtmdganvemaeeageenffifgmrvedvdrldqrgynaqeyydripelrqiieqls
    sgffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyknprewtrmvirnia
    tsgkfssdrtiaqyareiwgvepsrqrlpa