PDB entry 3ebc

View 3ebc on RCSB PDB site
Description: Structure of N141A HincII with Cognate DNA
Class: hydrolase/DNA
Keywords: intermediate, mutant, dimerization, R-loop, Endonuclease, Hydrolase, Nuclease, Restriction system, HYDROLASE-DNA COMPLEX
Deposited on 2008-08-27, released 2008-12-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Type-2 restriction enzyme HincII
    Species: Haemophilus influenzae [TaxId:727]
    Gene: hincIIR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17743 (Start-259)
      • conflict (131)
      • engineered (142)
      • conflict (174)
    Domains in SCOPe 2.08: d3ebca_
  • Chain 'B':
    Compound: Type-2 restriction enzyme HincII
    Species: Haemophilus influenzae [TaxId:727]
    Gene: hincIIR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17743 (Start-259)
      • conflict (131)
      • engineered (142)
      • conflict (174)
    Domains in SCOPe 2.08: d3ebcb_
  • Chain 'E':
    Compound: 5'-d(*dgp*dcp*dcp*dgp*dgp*dtp*dcp*dgp*dap*dcp*dgp*dgp*dgp*dc)-3'
  • Chain 'F':
    Compound: 5'-d(*dgp*dcp*dcp*dcp*dgp*dtp*dcp*dgp*dap*dcp*dcp*dgp*dgp*dc)-3'
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ebcA (A:)
    mamsfikpiyqdinsiligqkvkrpksgtlsghaagepfeklvykflkenlsdltfkqye
    ylndlfmknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillv
    kdqfyelldvktrnisksaqapaiisayklaqtcakmidnkefdlfdinylevdwelnge
    dlvcvstsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqa
    eqraismidkfvkpfkkyilrsrelvdpnsvqarlqdvdgtidtrsklaaaqlytrasqp
    elapedpedlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ebcA (A:)
    sfikpiyqdinsiligqkvgepfeklvykflkenlsdltfkqyeylndlfmknpaiighe
    aryklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdqfyelldvktrnia
    qapaiisayklaqtcakmidnkefdlfdinylevdwelngedlvcvstsfaelfksepse
    lyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqraismidkfvkpfkkyi
    l
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ebcB (B:)
    mamsfikpiyqdinsiligqkvkrpksgtlsghaagepfeklvykflkenlsdltfkqye
    ylndlfmknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillv
    kdqfyelldvktrnisksaqapaiisayklaqtcakmidnkefdlfdinylevdwelnge
    dlvcvstsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqa
    eqraismidkfvkpfkkyilrsrelvdpnsvqarlqdvdgtidtrsklaaaqlytrasqp
    elapedpedlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ebcB (B:)
    sfikpiyqdinsiligqkvkagepfeklvykflkenlsdltfkqyeylndlfmknpaiig
    hearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdqfyelldvktrn
    isaqapaiisayklaqtcakmidnkefdlfdinylevdwelngedlvcvstsfaelfkse
    pselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqraismidkfvkpfk
    kyil
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.