PDB entry 3eaj

View 3eaj on RCSB PDB site
Description: Crystal structure of SARS-CoV main protease quadruple mutant STIF/A with two molecules in one asymmetric unit
Class: hydrolase
Keywords: SARS coronavirus main protease mutant extra helical domain, Cytoplasm, Hydrolase, Membrane, Metal-binding, Protease, Ribosomal frameshifting, RNA-binding, Thiol protease, Transmembrane, Zinc, Zinc-finger
Deposited on 2008-08-26, released 2009-09-01
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-09-01, with a file datestamp of 2009-08-28.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.204
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3C-like proteinase
    Species: SARS coronavirus [TaxId:227859]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C6U8 (0-End)
      • engineered (283-285)
      • engineered (290)
    Domains in SCOPe 2.01: d3eaja_
  • Chain 'B':
    Compound: 3C-like proteinase
    Species: SARS coronavirus [TaxId:227859]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C6U8 (0-End)
      • engineered (283-285)
      • engineered (290)
    Domains in SCOPe 2.01: d3eajb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3eajA (A:)
    sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir
    ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng
    spsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk
    fygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye
    pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgaaaledeatpfdvvrqc
    sgvtfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eajA (A:)
    sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir
    ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng
    spsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk
    fygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye
    pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgaaaledeatpfdvvrqc
    sg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3eajB (B:)
    sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir
    ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng
    spsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk
    fygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye
    pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgaaaledeatpfdvvrqc
    sgvtfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3eajB (B:)
    sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir
    ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng
    spsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk
    fygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye
    pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgaaaledeatpfdvvrqc
    sg