PDB entry 3ea6

View 3ea6 on RCSB PDB site
Description: Atomic resolution of crystal structure of SEK
Class: toxin
Keywords: enterotoxin, superantigen
Deposited on 2008-08-24, released 2009-06-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-08-04, with a file datestamp of 2009-07-31.
Experiment type: XRAY
Resolution: 0.92 Å
R-factor: 0.101
AEROSPACI score: 1.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Staphylococcal enterotoxin K
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: sek, SACOL0886
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ea6a1, d3ea6a2
  • Heterogens: ZN, IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ea6A (A:)
    qgdigidnlrnfytkkdfvdlkdvkdndtpianqlqfsnesydliseskdfnkfsnfkgk
    kldvfgisyngqcntkyiyggvtatneyldksrnipiniwingnhktistnkvstnkkfv
    taqeidvklrkylqeeyniyghngtkkgeeyghkskfysgfnigkvtfhlnnndtfsydl
    fytgddglpksflkiyednktvesekfhldvdisyketi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ea6A (A:)
    digidnlrnfytkkdfvdlkdvkdndtpianqlqfsnesydliseskdfnkfsnfkgkkl
    dvfgisyngqcntkyiyggvtatneyldksrnipiniwingnhktistnkvstnkkfvta
    qeidvklrkylqeeyniyghngtkkgeeyghkskfysgfnigkvtfhlnnndtfsydlfy
    tgddglpksflkiyednktvesekfhldvdisyke