PDB entry 3ea5

View 3ea5 on RCSB PDB site
Description: Kap95p Binding Induces the Switch Loops of RanGDP to adopt the GTP-bound Conformation: Implications for Nuclear Import Complex Assembly Dynamics
Class: transport protein
Keywords: Karyopherin, Importin, Ran, GTP-binding, Host-virus interaction, Nucleotide-binding, Nucleus, Phosphoprotein, Protein transport, Transport, TRANSPORT PROTEIN
Deposited on 2008-08-24, released 2008-10-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.192
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP-binding nuclear protein ran
    Species: Homo sapiens [TaxId:9606]
    Gene: RAN, ARA24
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ea5a_
  • Chain 'B':
    Compound: Importin subunit beta-1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: KAP95
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06142 (0-860)
      • engineered (253)
    Domains in SCOPe 2.07: d3ea5b_
  • Chain 'C':
    Compound: GTP-binding nuclear protein ran
    Species: Homo sapiens [TaxId:9606]
    Gene: RAN, ARA24
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ea5c_
  • Chain 'D':
    Compound: Importin subunit beta-1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: KAP95
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06142 (0-860)
      • engineered (253)
    Domains in SCOPe 2.07: d3ea5d_
  • Heterogens: GDP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ea5A (A:)
    maaqgepqvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpik
    fnvwdtagqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlc
    gnkvdikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvamp
    clappevvmdpalaaqyehdlevaqttalpdedddl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ea5A (A:)
    epqvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwd
    tagqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvd
    ikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvam
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ea5B (B:)
    mstaefaqllensilspdqnirltsetqlkklsndnflqfaglssqvlidentklegril
    aaltlknelvskdsvktqqfaqrwitqvspeaknqiktnaltalvsieprianaaaqlia
    aiadielphgawpelmkimvdntgaeqpenvkrasllalgymcesadpqsqalvsssnni
    liaivqgaqstetskavrlaalnaladslifiknnmeregernylmqvvceatqaediev
    qaaafgclckimskyytfmkpymeqalyaltiatmkspndkvasmtvefwsticeeeidi
    ayelaqfpqsplqsynfalssikdvvpnllnlltrqnedpedddwnvsmsagaclqlfaq
    ncgnhilepvlefveqnitadnwrnreaavmafgsimdgpdkvqrtyyvhqalpsilnlm
    ndqslqvkettawcigriadsvaesidpqqhlpgvvqacliglqdhpkvatncswtiinl
    veqlaeatpspiynfypalvdgligaanridnefnarasafsalttmveyatdtvaetsa
    sistfvmdklgqtmsvdenqltledaqslqelqsniltvlaavirkspssvepvadmlmg
    lffrllekkdsafieddvfyaisalaaslgkgfekyletfspyllkalnqvdspvsitav
    gfiadisnsleedfrrysdammnvlaqmisnpnarrelkpavlsvfgdiasnigadfipy
    lndimalcvaaqntkpengtlealdyqikvleavldayvgivaglhdkpealfpyvgtif
    qfiaqvaedpqlysedatsraavgligdiaamfpdgsikqfygqdwvidyikrtrsgqlf
    sqatkdtarwareqqkrqlsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ea5B (B:)
    mstaefaqllensilspdqnirltsetqlkklsndnflqfaglssqvlidentklegril
    aaltlknelvskdsvktqqfaqrwitqvspeaknqiktnaltalvsieprianaaaqlia
    aiadielphgawpelmkimvdntgaeqpenvkrasllalgymcesadpqsqvsssnnili
    aivqgaqstetskavrlaalnaladslifiknnmeregernylmqvvceatqaedievqa
    aafgclckimskyytfmkpymeqalyaltiatmkspndkvasmtvefwsticeeeidiay
    elaqfpqsplqsynfalssikdvvpnllnlltrqnedpedddwnvsmsagaclqlfaqnc
    gnhilepvlefveqnitadnwrnreaavmafgsimdgpdkvqrtyyvhqalpsilnlmnd
    qslqvkettawcigriadsvaesidpqqhlpgvvqacliglqdhpkvatncswtiinlve
    qlaeatpspiynfypalvdgligaanridnefnarasafsalttmveyatdtvaetsasi
    stfvmdklgqtmsvdenqltledaqslqelqsniltvlaavirkspssvepvadmlmglf
    frllekkdsafieddvfyaisalaaslgkgfekyletfspyllkalnqvdspvsitavgf
    iadisnsleedfrrysdammnvlaqmisnpnarrelkpavlsvfgdiasnigadfipyln
    dimalcvaaqntkpengtlealdyqikvleavldayvgivaglhdkpealfpyvgtifqf
    iaqvaedpqlysedatsraavgligdiaamfpdgsikqfygqdwvidyikrtrsgqlfsq
    atkdtarwareqqkrqlsl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ea5C (C:)
    maaqgepqvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpik
    fnvwdtagqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlc
    gnkvdikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvamp
    clappevvmdpalaaqyehdlevaqttalpdedddl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ea5C (C:)
    vqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdtag
    qekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdikd
    rkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ea5D (D:)
    mstaefaqllensilspdqnirltsetqlkklsndnflqfaglssqvlidentklegril
    aaltlknelvskdsvktqqfaqrwitqvspeaknqiktnaltalvsieprianaaaqlia
    aiadielphgawpelmkimvdntgaeqpenvkrasllalgymcesadpqsqalvsssnni
    liaivqgaqstetskavrlaalnaladslifiknnmeregernylmqvvceatqaediev
    qaaafgclckimskyytfmkpymeqalyaltiatmkspndkvasmtvefwsticeeeidi
    ayelaqfpqsplqsynfalssikdvvpnllnlltrqnedpedddwnvsmsagaclqlfaq
    ncgnhilepvlefveqnitadnwrnreaavmafgsimdgpdkvqrtyyvhqalpsilnlm
    ndqslqvkettawcigriadsvaesidpqqhlpgvvqacliglqdhpkvatncswtiinl
    veqlaeatpspiynfypalvdgligaanridnefnarasafsalttmveyatdtvaetsa
    sistfvmdklgqtmsvdenqltledaqslqelqsniltvlaavirkspssvepvadmlmg
    lffrllekkdsafieddvfyaisalaaslgkgfekyletfspyllkalnqvdspvsitav
    gfiadisnsleedfrrysdammnvlaqmisnpnarrelkpavlsvfgdiasnigadfipy
    lndimalcvaaqntkpengtlealdyqikvleavldayvgivaglhdkpealfpyvgtif
    qfiaqvaedpqlysedatsraavgligdiaamfpdgsikqfygqdwvidyikrtrsgqlf
    sqatkdtarwareqqkrqlsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ea5D (D:)
    mstaefaqllensilspdqnirltsetqlkklsndnflqfaglssqvlidentklegril
    aaltlknelvskdsvktqqfaqrwitqvspeaknqiktnaltalvsieprianaaaqlia
    aiadielphgawpelmkimvdntgaeqpenvkrasllalgymcesaniliaivqgaqste
    tskavrlaalnaladslifiknnmeregernylmqvvceatqaedievqaaafgclckim
    skyytfmkpymeqalyaltiatmkspndkvasmtvefwsticeeeidiayelaqfpqspl
    qsynfalssikdvvpnllnlltrqnedpedddwnvsmsagaclqlfaqncgnhilepvle
    fveqnitadnwrnreaavmafgsimdgpdkvqrtyyvhqalpsilnlmndqslqvketta
    wcigriadsvaesidpqqhlpgvvqacliglqdhpkvatncswtiinlveqlaeatpspi
    ynfypalvdgligaanridnefnarasafsalttmveyatdtvaetsasistfvmdklgq
    tmsvdenqltledaqslqelqsniltvlaavirkspssvepvadmlmglffrllekkdsa
    fieddvfyaisalaaslgkgfekyletfspyllkalnqvdspvsitavgfiadisnslee
    dfrrysdammnvlaqmisnpnarrelkpavlsvfgdiasnigadfipylndimalcvaaq
    ntkpengtlealdyqikvleavldayvgivaglhdkpealfpyvgtifqfiaqvaedpql
    ysedatsraavgligdiaamfpdgsikqfygqdwvidyikrtrsgqlfsqatkdtarwar
    eqqkrqlsl