PDB entry 3ea4

View 3ea4 on RCSB PDB site
Description: Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron-ester
Class: transferase
Keywords: FAD and ThDP dependent enzyme, Amino-acid biosynthesis, Branched-chain amino acid biosynthesis, Chloroplast, FAD, Flavoprotein, Herbicide resistance, Magnesium, Metal-binding, Thiamine pyrophosphate, Transferase, Transit peptide
Deposited on 2008-08-24, released 2009-03-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.2
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acetolactate synthase, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: CSR 1.2, At3g48560, T8P19.70
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17597 (0-End)
      • conflict (243)
    Domains in SCOPe 2.07: d3ea4a1, d3ea4a2, d3ea4a3
  • Heterogens: 2SM, FAB, NHE, TDM, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ea4A (A:)
    fisrfapdqprkgadilvealerqgvetvfaypggasmeihqaltrsssirnvlprheqg
    gvfaaegyarssgkpgiciatsgpgatnlvsgladalldsvplvaitgqvprrmigtdaf
    qetpivevtrsitkhnylvmdvedipriieeafflatsgrpgpvlvdvpkdiqqqlaipn
    weqamrlpgymsrmpkppedshleqivrliseskkpvlyvgggclnssdelgrfveltgi
    pvattlmglgsypcddelslhmlgmhgtvyanyavehsdlllafgvrfddrvtgkleafa
    srakivhididsaeigknktphvsvcgdvklalqgmnkvlenraeelkldfgvwrnelnv
    qkqkfplsfktfgeaippqyaikvldeltdgkaiistgvgqhqmwaaqfynykkprqwls
    sgglgamgfglpaaigasvanpdaivvdidgdgsfimnvqelatirvenlpvkvlllnnq
    hlgmvmqwedrfykanrahtflgdpaqedeifpnmllfaaacgipaarvtkkadlreaiq
    tmldtpgpylldvicphqehvlpmipsggtfndvitegdgriky
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ea4A (A:)
    fisrfapdqprkgadilvealerqgvetvfaypggasmeihqaltrsssirnvlprheqg
    gvfaaegyarssgkpgiciatsgpgatnlvsgladalldsvplvaitgqvprrmigtdaf
    qetpivevtrsitkhnylvmdvedipriieeafflatsgrpgpvlvdvpkdiqqqlaipn
    weqamrlpgymsrmpkppedshleqivrliseskkpvlyvgggclnssdelgrfveltgi
    pvattlmglgsypcddelslhmlgmhgtvyanyavehsdlllafgvrfddrvtgkleafa
    srakivhididsaeigknktphvsvcgdvklalqgmnkvlenraeelkldfgvwrnelnv
    qkqkfplsfktfgeaippqyaikvldeltdgkaiistgvgqhqmwaaqfynykkprqwls
    sgglgamgfglpaaigasvanpdaivvdidgdgsfimnvqelatirvenlpvkvlllnnq
    hlgmvmqwedrfykanrahtflgdpaqedeifpnmllfaaacgipaarvtkkadlreaiq
    tmldtpgpylldvicphqehvlpmipsggtfndvitegdgri