PDB entry 3ea2

View 3ea2 on RCSB PDB site
Description: Crystal Structure of the Myo-inositol bound Y247S/Y251S Mutant of Phosphatidylinositol-Specific Phospholipase C from Bacillus Thuringiensis
Class: lyase
Keywords: phosphatidylinositol-specific phospholipase C, myo-inositol, PI-PLC, Dimer, interfacially impaired, membrane binding, TIM barrel, Lipid degradation, Lyase, Secreted
Deposited on 2008-08-24, released 2009-04-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1-phosphatidylinositol phosphodiesterase
    Species: BACILLUS THURINGIENSIS [TaxId:1428]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08954 (0-End)
      • engineered (246)
      • engineered (250)
    Domains in SCOPe 2.08: d3ea2a_
  • Chain 'B':
    Compound: 1-phosphatidylinositol phosphodiesterase
    Species: BACILLUS THURINGIENSIS [TaxId:1428]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08954 (0-End)
      • engineered (246)
      • engineered (250)
    Domains in SCOPe 2.08: d3ea2b_
  • Heterogens: INS, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ea2A (A:)
    assvnelenwskwmqpipdniplarisipgthdsgtfklqnpikqvwgmtqeydfryqmd
    hgarifdirgrltddntivlhhgplylyvtlhefineakqflkdnpsetiimslkkeyed
    mkgaegsfsstfeknyfvdpiflktegniklgdargkivllkrysgsnesggynnfywpd
    netftttvnqnvnvtvqdkykvnydekvksikdtmdetmnnsedlnhlyinftslssggt
    awnspysyassinpeiandikqknptrvgwviqdyinekwspllyqevirankslike
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ea2A (A:)
    assvnelenwskwmqpipdniplarisipgthdsgtfklqnpikqvwgmtqeydfryqmd
    hgarifdirgrltddntivlhhgplylyvtlhefineakqflkdnpsetiimslkkeyed
    mkgaegsfsstfeknyfvdpiflktegniklgdargkivllkrysgsnesggynnfywpd
    netftttvnqnvnvtvqdkykvnydekvksikdtmdetmnnsedlnhlyinftslssggt
    awnspysyassinpeiandikqknptrvgwviqdyinekwspllyqeviranksli
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ea2B (B:)
    assvnelenwskwmqpipdniplarisipgthdsgtfklqnpikqvwgmtqeydfryqmd
    hgarifdirgrltddntivlhhgplylyvtlhefineakqflkdnpsetiimslkkeyed
    mkgaegsfsstfeknyfvdpiflktegniklgdargkivllkrysgsnesggynnfywpd
    netftttvnqnvnvtvqdkykvnydekvksikdtmdetmnnsedlnhlyinftslssggt
    awnspysyassinpeiandikqknptrvgwviqdyinekwspllyqevirankslike
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ea2B (B:)
    assvnelenwskwmqpipdniplarisipgthdsgtfklqnpikqvwgmtqeydfryqmd
    hgarifdirgrltddntivlhhgplylyvtlhefineakqflkdnpsetiimslkkeyed
    mkgaegsfsstfeknyfvdpiflktegniklgdargkivllkrysgsnesggynnfywpd
    netftttvnqnvnvtvqdkykvnydekvksikdtmdetmnnsedlnhlyinftslssggt
    awnspysyassinpeiandikqknptrvgwviqdyinekwspllyqeviranksli