PDB entry 3ea0

View 3ea0 on RCSB PDB site
Description: Crystal Structure of ParA Family ATPase from Chlorobium tepidum TLS
Class: hydrolase
Keywords: alpha-beta-alpha sandwich, structural genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, HYDROLASE
Deposited on 2008-08-24, released 2008-09-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.197
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATPase, ParA family
    Species: Chlorobium tepidum [TaxId:194439]
    Gene: CT0433
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8KF94 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.06: d3ea0a1, d3ea0a2
  • Chain 'B':
    Compound: ATPase, ParA family
    Species: Chlorobium tepidum [TaxId:194439]
    Gene: CT0433
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8KF94 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.06: d3ea0b1, d3ea0b2
  • Heterogens: ATP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ea0A (A:)
    snakrvfgfvsakggdggsciaanfafalsqepdihvlavdislpfgdldmylsgnthsq
    dladisnasdrldkslldtmvqhispsldlipspatfekivniepervsdlihiaasfyd
    yiivdfgasidhvgvwvlehldelcivttpslqslrragqllklckefekpisrieiiln
    radtnsritsdeiekvigrpiskripqdedamqesllsgqsvlkvapksqlsktivdwal
    hlngv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ea0A (A:)
    akrvfgfvsakggdggsciaanfafalsqepdihvlavdislpfgdldmylsgnthsqdl
    adisnasdrldkslldtmvqhispsldlipspatfekivniepervsdlihiaasfydyi
    ivdfgasidhvgvwvlehldelcivttpslqslrragqllklckefekpisrieiilnra
    dtnsritsdeiekvigrpiskripqdedamqesllsgqsvlkvapksqlsktivdwalhl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ea0B (B:)
    snakrvfgfvsakggdggsciaanfafalsqepdihvlavdislpfgdldmylsgnthsq
    dladisnasdrldkslldtmvqhispsldlipspatfekivniepervsdlihiaasfyd
    yiivdfgasidhvgvwvlehldelcivttpslqslrragqllklckefekpisrieiiln
    radtnsritsdeiekvigrpiskripqdedamqesllsgqsvlkvapksqlsktivdwal
    hlngv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ea0B (B:)
    snakrvfgfvsakggdggsciaanfafalsqepdihvlavdislpfgdldmylsgnthsq
    dladisnasdrldkslldtmvqhispsldlipspatfekivniepervsdlihiaasfyd
    yiivdfgasidhvgvwvlehldelcivttpslqslrragqllklckefekpisrieiiln
    radtsritsdeiekvigrpiskripqdedamqesllsgqsvlkvapksqlsktivdwalh
    ln