PDB entry 3e9i

View 3e9i on RCSB PDB site
Description: Lysyl-tRNA synthetase from Bacillus stearothermophilus complexed with L-Lysine hydroxamate-AMP
Class: Ligase
Keywords: aminoacyl tRNA synthetase, LIGASE, PROTEIN BIOSYNTHESIS, ATP-binding, Cytoplasm, Magnesium, Metal-binding, Nucleotide-binding
Deposited on 2008-08-22, released 2009-07-14
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-07-14, with a file datestamp of 2009-07-10.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.182
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysyl-tRNA synthetase
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3e9ia1, d3e9ia2
  • Chain 'B':
    Compound: lysyl-tRNA synthetase
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3e9ib1, d3e9ib2
  • Chain 'C':
    Compound: lysyl-tRNA synthetase
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3e9ic1, d3e9ic2
  • Chain 'D':
    Compound: lysyl-tRNA synthetase
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3e9id1, d3e9id2
  • Heterogens: MG, XAH, 1PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3e9iA (A:)
    sheelndqlrvrreklkkieelgvdpfgkrferthkaeelfelygdlskeeleeqqieva
    vagrimtkrgmgkagfahiqdvtgqiqiyvrqddvgeqqyelfkisdlgdivgvrgtmfk
    tkvgelsikvssyefltkalrplpekyhglkdieqryrqryldlimnpeskktfitrsli
    iqsmrryldshgylevetpmmhavaggaaarpfithhnaldmtlymriaielhlkrlivg
    glekvyeigrvfrnegistrhnpeftmlelyeayadfrdimkltenliahiatevlgttk
    iqygehlvdltpewrrlhmvdaikeyvgvdfwrqmsdeearelakehgvevaphmtfghi
    vneffeqkvedkliqptfiyghpveisplakknpddprftdrfelfivgrehanafteln
    dpidqrqrfeeqlkereqgndeahemdedflealeygmpptgglgigvdrlvmlltnsps
    irdvllfpqmrhk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e9iA (A:)
    elndqlrvrreklkkieelgvdpfgkrferthkaeelfelygdlskeeleeqqievavag
    rimtkrgmgkagfahiqdvtgqiqiyvrqddvgeqqyelfkisdlgdivgvrgtmfktkv
    gelsikvssyefltkalrplpekdieqryrqryldlimnpeskktfitrsliiqsmrryl
    dshgylevetpmmhavaggaaarpfithhnaldmtlymriaielhlkrlivgglekvyei
    grvfrnegistrhnpeftmlelyeayadfrdimkltenliahiatevlgttkiqygehlv
    dltpewrrlhmvdaikeyvgvdfwrqmsdeearelakehgvevaphmtfghivneffeqk
    vedkliqptfiyghpveisplakknpddprftdrfelfivgrehanaftelndpidqrqr
    feeqlkereqgndeahemdedflealeygmpptgglgigvdrlvmlltnspsirdvllfp
    qmrh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3e9iB (B:)
    sheelndqlrvrreklkkieelgvdpfgkrferthkaeelfelygdlskeeleeqqieva
    vagrimtkrgmgkagfahiqdvtgqiqiyvrqddvgeqqyelfkisdlgdivgvrgtmfk
    tkvgelsikvssyefltkalrplpekyhglkdieqryrqryldlimnpeskktfitrsli
    iqsmrryldshgylevetpmmhavaggaaarpfithhnaldmtlymriaielhlkrlivg
    glekvyeigrvfrnegistrhnpeftmlelyeayadfrdimkltenliahiatevlgttk
    iqygehlvdltpewrrlhmvdaikeyvgvdfwrqmsdeearelakehgvevaphmtfghi
    vneffeqkvedkliqptfiyghpveisplakknpddprftdrfelfivgrehanafteln
    dpidqrqrfeeqlkereqgndeahemdedflealeygmpptgglgigvdrlvmlltnsps
    irdvllfpqmrhk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e9iB (B:)
    elndqlrvrreklkkieelgvdpfgkrferthkaeelfelygdlskeeleeqqievavag
    rimtkrgmgkagfahiqdvtgqiqiyvrqddvgeqqyelfkisdlgdivgvrgtmfktkv
    gelsikvssyefltkalrplpekdieqryrqryldlimnpeskktfitrsliiqsmrryl
    dshgylevetpmmhavaggaaarpfithhnaldmtlymriaielhlkrlivgglekvyei
    grvfrnegistrhnpeftmlelyeayadfrdimkltenliahiatevlgttkiqygehlv
    dltpewrrlhmvdaikeyvgvdfwrqmsdeearelakehgvevaphmtfghivneffeqk
    vedkliqptfiyghpveisplakknpddprftdrfelfivgrehanaftelndpidqrqr
    feeqlkereqgndeahemdedflealeygmpptgglgigvdrlvmlltnspsirdvllfp
    qmrh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3e9iC (C:)
    sheelndqlrvrreklkkieelgvdpfgkrferthkaeelfelygdlskeeleeqqieva
    vagrimtkrgmgkagfahiqdvtgqiqiyvrqddvgeqqyelfkisdlgdivgvrgtmfk
    tkvgelsikvssyefltkalrplpekyhglkdieqryrqryldlimnpeskktfitrsli
    iqsmrryldshgylevetpmmhavaggaaarpfithhnaldmtlymriaielhlkrlivg
    glekvyeigrvfrnegistrhnpeftmlelyeayadfrdimkltenliahiatevlgttk
    iqygehlvdltpewrrlhmvdaikeyvgvdfwrqmsdeearelakehgvevaphmtfghi
    vneffeqkvedkliqptfiyghpveisplakknpddprftdrfelfivgrehanafteln
    dpidqrqrfeeqlkereqgndeahemdedflealeygmpptgglgigvdrlvmlltnsps
    irdvllfpqmrhk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e9iC (C:)
    elndqlrvrreklkkieelgvdpfgkrferthkaeelfelygdlskeeleeqqievavag
    rimtkrgmgkagfahiqdvtgqiqiyvrqddvgeqqyelfkisdlgdivgvrgtmfktkv
    gelsikvssyefltkalrplpekdieqryrqryldlimnpeskktfitrsliiqsmrryl
    dshgylevetpmmhavaggaaarpfithhnaldmtlymriaielhlkrlivgglekvyei
    grvfrnegistrhnpeftmlelyeayadfrdimkltenliahiatevlgttkiqygehlv
    dltpewrrlhmvdaikeyvgvdfwrqmsdeearelakehgvevaphmtfghivneffeqk
    vedkliqptfiyghpveisplakknpddprftdrfelfivgrehanaftelndpidqrqr
    feeqlkereqgndeahemdedflealeygmpptgglgigvdrlvmlltnspsirdvllfp
    qmrh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3e9iD (D:)
    sheelndqlrvrreklkkieelgvdpfgkrferthkaeelfelygdlskeeleeqqieva
    vagrimtkrgmgkagfahiqdvtgqiqiyvrqddvgeqqyelfkisdlgdivgvrgtmfk
    tkvgelsikvssyefltkalrplpekyhglkdieqryrqryldlimnpeskktfitrsli
    iqsmrryldshgylevetpmmhavaggaaarpfithhnaldmtlymriaielhlkrlivg
    glekvyeigrvfrnegistrhnpeftmlelyeayadfrdimkltenliahiatevlgttk
    iqygehlvdltpewrrlhmvdaikeyvgvdfwrqmsdeearelakehgvevaphmtfghi
    vneffeqkvedkliqptfiyghpveisplakknpddprftdrfelfivgrehanafteln
    dpidqrqrfeeqlkereqgndeahemdedflealeygmpptgglgigvdrlvmlltnsps
    irdvllfpqmrhk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e9iD (D:)
    elndqlrvrreklkkieelgvdpfgkrferthkaeelfelygdlskeeleeqqievavag
    rimtkrgmgkagfahiqdvtgqiqiyvrqddvgeqqyelfkisdlgdivgvrgtmfktkv
    gelsikvssyefltkalrplpekdieqryrqryldlimnpeskktfitrsliiqsmrryl
    dshgylevetpmmhavaggaaarpfithhnaldmtlymriaielhlkrlivgglekvyei
    grvfrnegistrhnpeftmlelyeayadfrdimkltenliahiatevlgttkiqygehlv
    dltpewrrlhmvdaikeyvgvdfwrqmsdeearelakehgvevaphmtfghivneffeqk
    vedkliqptfiyghpveisplakknpddprftdrfelfivgrehanaftelndpidqrqr
    feeqlkereqgndeahemdedflealeygmpptgglgigvdrlvmlltnspsirdvllfp
    qmrh