PDB entry 3e9b

View 3e9b on RCSB PDB site
Description: X-ray structure of rat arginase I-T135A mutant: the complex with BEC
Class: hydrolase
Keywords: amino acid recognition, arginase mutant, T135A, BEC, Arginine metabolism, Hydrolase, Manganese, Metal-binding, Phosphoprotein, Urea cycle
Deposited on 2008-08-21, released 2008-12-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.216
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Arginase-1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: ARG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07824
      • engineered (134)
    Domains in SCOPe 2.07: d3e9ba_
  • Chain 'B':
    Compound: Arginase-1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: ARG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07824
      • engineered (134)
    Domains in SCOPe 2.07: d3e9bb_
  • Chain 'C':
    Compound: Arginase-1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: ARG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07824
      • engineered (134)
    Domains in SCOPe 2.07: d3e9bc_
  • Heterogens: MN, S2C, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3e9bA (A:)
    msskpkpieiigapfskgqprggvekgpaalrkaglveklketeynvrdhgdlafvdvpn
    dspfqivknprsvgkaneqlaavvaetqkngtisvvlggdhsmaigsisgharvhpdlcv
    iwvdahtdintpltassgnlhgqpvafllkelkgkfpdvpgfswvtpcisakdivyiglr
    dvdpgehyiiktlgikyfsmtevdklgigkvmeetfsyllgrkkrpihlsfdvdgldpvf
    tpatgtpvvgglsyreglyiteeiyktgllsgldimevnptlgktpeevtrtvntavalt
    lscfgtkregnhkpetdylkppk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e9bA (A:)
    kpieiigapfskgqprggvekgpaalrkaglveklketeynvrdhgdlafvdvpndspfq
    ivknprsvgkaneqlaavvaetqkngtisvvlggdhsmaigsisgharvhpdlcviwvda
    htdintpltassgnlhgqpvafllkelkgkfpdvpgfswvtpcisakdivyiglrdvdpg
    ehyiiktlgikyfsmtevdklgigkvmeetfsyllgrkkrpihlsfdvdgldpvftpatg
    tpvvgglsyreglyiteeiyktgllsgldimevnptlgktpeevtrtvntavaltlscfg
    tkregnhk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3e9bB (B:)
    msskpkpieiigapfskgqprggvekgpaalrkaglveklketeynvrdhgdlafvdvpn
    dspfqivknprsvgkaneqlaavvaetqkngtisvvlggdhsmaigsisgharvhpdlcv
    iwvdahtdintpltassgnlhgqpvafllkelkgkfpdvpgfswvtpcisakdivyiglr
    dvdpgehyiiktlgikyfsmtevdklgigkvmeetfsyllgrkkrpihlsfdvdgldpvf
    tpatgtpvvgglsyreglyiteeiyktgllsgldimevnptlgktpeevtrtvntavalt
    lscfgtkregnhkpetdylkppk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e9bB (B:)
    kpieiigapfskgqprggvekgpaalrkaglveklketeynvrdhgdlafvdvpndspfq
    ivknprsvgkaneqlaavvaetqkngtisvvlggdhsmaigsisgharvhpdlcviwvda
    htdintpltassgnlhgqpvafllkelkgkfpdvpgfswvtpcisakdivyiglrdvdpg
    ehyiiktlgikyfsmtevdklgigkvmeetfsyllgrkkrpihlsfdvdgldpvftpatg
    tpvvgglsyreglyiteeiyktgllsgldimevnptlgktpeevtrtvntavaltlscfg
    tkregnhk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3e9bC (C:)
    msskpkpieiigapfskgqprggvekgpaalrkaglveklketeynvrdhgdlafvdvpn
    dspfqivknprsvgkaneqlaavvaetqkngtisvvlggdhsmaigsisgharvhpdlcv
    iwvdahtdintpltassgnlhgqpvafllkelkgkfpdvpgfswvtpcisakdivyiglr
    dvdpgehyiiktlgikyfsmtevdklgigkvmeetfsyllgrkkrpihlsfdvdgldpvf
    tpatgtpvvgglsyreglyiteeiyktgllsgldimevnptlgktpeevtrtvntavalt
    lscfgtkregnhkpetdylkppk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3e9bC (C:)
    kpieiigapfskgqprggvekgpaalrkaglveklketeynvrdhgdlafvdvpndspfq
    ivknprsvgkaneqlaavvaetqkngtisvvlggdhsmaigsisgharvhpdlcviwvda
    htdintpltassgnlhgqpvafllkelkgkfpdvpgfswvtpcisakdivyiglrdvdpg
    ehyiiktlgikyfsmtevdklgigkvmeetfsyllgrkkrpihlsfdvdgldpvftpatg
    tpvvgglsyreglyiteeiyktgllsgldimevnptlgktpeevtrtvntavaltlscfg
    tkregnhk